Examples of RESULT (c)

In the figures below,

Red spheres indicate the position of ANGL_CORE residues, orange spheres the position of ANGL residues, and yellow spheres the position of ANGL_SUPP residues, respectively.

Large spheres indicate the position of FLEX/D2/PB/DSSP variable residue positions.

Structural superpositions of Ca traces were carried out with the DaliLite server.

Backbone structures are obtained using ProteinViewer, where N-terminal is colored red and C-terminal blue.

dPHI, dPSI: Changes in dihedral angles, PHI and PSI. The value range [0, 180] of dPHI and dPSI is divided into 11 segments: 0=[0,10), 1=[10,20), 2=[20,30), ..., 9=[90,100), X=[100,180]. Note that ANGL_SUPP <=> "dPHI>0 || dPSI>0," ANGL <=> "dPHI>=3 || dPSI>=3," and ANGL_CORE <=> "(dPHI>=3 && dPSI>=3) || (dPHI>=X || dPSI>=X)."

(1) Domain-swapped Dimers

(a) Monomeric / Homo-multimeric: PpL (Cluster 29, PDBID: 1k50 A and 1k50 B)

Superposition of the Ca traces (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: EEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTADVADKGYTLNIKFAG dPHI : -01100001010001000120100000000000000000011100002135XXX52011001X dPSI : X0300000010110000100110000000000000000000000001033XXXXX011000X- ANGL_SUPP : - xx xxxxx x xxxxx xxx xxxxxxxxxxxxx x- ANGL : x xxxxxxx x ANGL_CORE : - xxxxxx x- D2 : -- xx xxxxxxx -- PB : --x x xxxxxxxx x-- DSSP : xxxxxxxxxxxxxxxx Fatcat : 11111111111111111111111111111111111111111111111111111 FlexProt : 11111111111111111111111111111111111111111111111111111111 Rapid : 11111111111111111111111111111111111111111111111111xxx DynDom : No dynamic domains were found FLEX : xxxxxxxxxxxxx

(b) Conformations of the hinge regions

Cluster 6 (PDBID: 1bmb A and 1fyr B)

Superposition of the Ca traces of the hinge (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE dPHI : -001000002000000000000001000000001000000010010021020000011110110100330000000000001100000000101100 dPSI : 20210000200000000000000200000000100100000000011010000000201000100XX12000000000100100000000100001- ANGL_SUPP : - xx xx xx xx x x xxxxx x xxxx xx xxxxx x xx xx xxx- ANGL : - xxxx - ANGL_CORE : - xx - D2 : -- x x x x x x -- PB : -- x xxxx xxxxx -- DSSP : x x x xx xx xxx x Fatcat : 1111111111111111111111111111111111111111111111111111111111111111112222222222222222222222222222222 FlexProt : 1111111111111111111111111111111111111111111111111111111111111111111222222222222222222222222222222 Rapid : 1111111111111111111111111111111111111111111111111111111111111111111222222222222222222222222222222 DynDom : 11111111111111111111111111111111111111111111111111111111111111xxxxx22222222222222222222222222 FLEX : xxx xxxxx xxx

Cluster 23 (PDBID: 1huf A and 1k46 A)

Superposition of the Ca traces of the hinge (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: LSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQES dPHI : -000100000000000000001000152000112000000000000000000000000010102000100100000000002100100001XXX42100000100000000000001001003 dPSI : 2100000000000000000000000XX10010300000000000000000000000000100300110001100000000130010000021713100000000000000000000000000- ANGL_SUPP : -x x x xxx xxxx x xxx xxx xx xxx xx xxxxxxx x x x - ANGL : - xx x x x xxxx - ANGL_CORE : - xx xxxx - D2 : -- x x x xx -- PB : --x xxxxx xxxxxx -- DSSP : x xxxxxxxxxx xx x x Fatcat : 111111111111111111111111112222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222 FlexProt : 111111111111111111111111122222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222 Rapid : 111111111111111111111111112222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222 DynDom : 1111111111111111111111xxxxx22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222 FLEX : xx xxxxx xx

Cluster 53 (PDBID: 1y50 A and 1y51 A)

Superposition of the Ca traces of the hinge (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: AEKTFKVVSDSGIHARPATILVQTASKWNSEIQLEYNGKTVNLKSIMGVMSLGIPKGATIKITAEGADAAEAMAALTDTLAKEGLAE dPHI : -0001000003005X000100010000121020012021000000000015122101000000000100000000000000100010 dPSI : 0001100001200192010000100100112100010011000000010340X010110000000010000000000000010000- ANGL_SUPP : - xx xx xxx xx x x xxxxx xx xxx x xxxxxx xx x x x- ANGL : - x xx xx x - ANGL_CORE : - x x x - D2 : -- x xx xx -- PB : -- xxxx x x xxx -- DSSP : xxxxxx xx xxx xxxxxxx x Fatcat : 111111111111111111111111111111111111111111111111111122222222222222222222222222222222222 FlexProt : 111111111111111111111111111111111111111111111111111112222222222222222222222222222222222 Rapid : 11111111111111111111111111111111111111111111111xxxxx22222222222222222222222222222222222 DynDom : 1111111111111111111111111111111111111111111111111xxxx222222222222222222222222222222 FLEX : xx xxxxxxxx xx

Cluster 8 (PDBID: 1c0b A and 1f0v A)

Superposition of the Ca traces of the hinge (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV dPHI : -772010000020015111X23040000100122142X01010000202300100001100113225XX9X1000102201010008XX25X3152010212122110113X400000103X3X dPSI : XXX010001020006000328105100010030113X35110000103210000010020003206X42X220002520110001053X24X01310020112110000152X2240122829- ANGL_SUPP : -xxxxx x xx xxxxxxxx xx x xxxxxxxxxxx xxxxx x x xx xxxxxxxxxxx xxxxxx x x xxxxxxxxxx xxxxxxxxxx xxxxxxxx xxxxxx- ANGL : -xx xx xxxx x x xxxx x x xx xxxxxx x xxx xxx x xxx x xxx- ANGL_CORE : -xx x x xxx xxxxx xxx xx x xxx xxx- D2 : --xx xx x x xx xx xx xx x x xxx xxxx xx -- PB : --xxx x xx xxxxxx xxxxxx xx x xxxx xxxxxx xxxx xxxxxxxxx xxxxxx xxxxxx x-- DSSP : x x x xx xx xx x xxxxxxx xxxxxxxxxxxx Fatcat : 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 FlexProt : 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111 Rapid : 111111111111111111xxx111111111111111111xx11111111111111111111111xxxx11111111111111xxxxx 11111111111111111111x DynDom : No dynamic domains were found FLEX : xx xxx xx xxxx xxxxxxxx xxxx

Cluster 4 (PDBID: 1aoj A and 1i0c A)

Superposition of the Ca traces of the hinge (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP dPHI : -2110300111013113303000103100XXX751400110121502000010002320 dPSI : 1021201101123022302100013100X5321X400002012430100021001102- ANGL_SUPP : -xxxxxxxxxxxxxxxxxxx xxxx xxxxxxxx xx xxxx x xx xxxx- ANGL : - x xx xx x xx xxxxxxxx xx x - ANGL_CORE : - x xxxx x x - D2 : -- x x xx xx x x -- PB : -- xxxx xxxxxxx x xxxx xxx -- DSSP : x x x xxxxxx xxxx Fatcat : 11111111111111111111111111111111x22222222222222222222222222 FlexProt : 11111111111111111111111111111111122222222222222222222222222 Rapid : 11111111111111111111111111111xx 2222222222222222222222222 DynDom : 11111111111111111111111111111xxxxx222222222222222222222 FLEX : xx xxxxxxx xx

Cluster 29 (PDBID: 1k50 A and 1k50 B)

Superposition of the Ca traces of the hinge (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		Hinge : ^^^^^^^^^^ Amino Acid: EEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTADVADKGYTLNIKFAG dPHI : -01100001010001000120100000000000000000011100002135XXX52011001X dPSI : X0300000010110000100110000000000000000000000001033XXXXX011000X- ANGL_SUPP : - xx xxxxx x xxxxx xxx xxxxxxxxxxxxx x- ANGL : - x xxxxxxx x- ANGL_CORE : - xxxxxx x- D2 : -- xx xxxxxxx -- PB : --x x xxxxxxxx x-- DSSP : xxxxxxxxxxxxxxxx Fatcat : 11111111111111111111111111111111111111111111111111111 FlexProt : 11111111111111111111111111111111111111111111111111111111 Rapid : 11111111111111111111111111111111111111111111111111xxx DynDom : No dynamic domains were found FLEX : xxxxxxxxxxxxx

(2) Other examples

(a) Member of a dimer: The V domain of Bence-Jones protein Mcg (Cluster 11, PDBID: 1dcl A and 1dcl B)

Superposition of the Ca traces (Large spheres indicate D2 variable residues)		Hinge region Amino acid code Changes in PHI/PSI Variable residue positions (ANGLs/D2/PB/DSSP) Rigid bodies detected by FATCAT/FlexProt/RAPIDO/DynDom
		CDR1 CDR2 CDR3 <-------> <-----> <--------> Amino Acid: PSALTQPPSASGSLGQSVTISCTGTSSNVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVT... dPHI : -XX500011152213151512014110XX1XXX310002131002211010101111X3603212002321100221000011002221000X5X7X412012X2022... dPSI : X20300110101210324220015XXX65062600001032110001010002020X03203200112020002101300100012201001257X042002X42101... ANGL_SUPP : -xxx xxxxxxxxxxxxxxx xxxxxxxxxxxxx xxxxxx xxxxxx xxxxxxxxx xxxxxxxxxxx xxxxx xxx xxxxx xxxxxxxxx xxxxxxx... ANGL : xxx x xxxxx xxxxxx xxxx xx xxxx x x x xxxxxx xx ... ANGL_CORE : xxx xxxxxx xxx xxx x xxxxxx xx ... D2 : -- x xxxxxx x x x x xx xxx x x ... PB : --xx xxxxxxxxxx xxxxxxxx xxx xxx x xxxxx xxx xxx xxxxx ... DSSP : x x xxx x x xxxxxxxxx x x xxx x xx x x x x... Fatcat : 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111... FlexProt : 111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111... Rapid : 222222222222222222222xxxxx 2222222222222222222222222222222222222222222222222222222222222xxxx22222222222... DynDom : No dynamic domains were found FLEX : xxx xxxxxxxx xxxx ...

RESULT (a) Examples (detailed information of changes in PHI/PSI dihedral angles)

(1) Domain-swapped Dimers

(2) Other examples