INPUT SEQUENCE (A) : data/seq_a.code
INPUT SEQUENCE (B) : data/seq_b.code
SUBSEQUENCE OPTION : Whole sequence comparison
EXEC OPTION : [Length only] Hunt and Szymanski's algorithm
1-th target : lcs/trimmed_seq_a = 0.633 (= 31/ 49), lcs/trimmed_seq_b = 0.646 (= 31/ 48), seq_b_name = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.50/1k8bA00/1k8bA00.pdb c1
2-th target : lcs/trimmed_seq_a = 0.673 (= 33/ 49), lcs/trimmed_seq_b = 0.717 (= 33/ 46), seq_b_name = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.70/1uglA00/1uglA00.pdb c1
3-th target : lcs/trimmed_seq_a = 0.673 (= 33/ 49), lcs/trimmed_seq_b = 0.688 (= 33/ 48), seq_b_name = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.60/1xrsB01/1xrsB01.pdb c1
4-th target : lcs/trimmed_seq_a = 0.633 (= 31/ 49), lcs/trimmed_seq_b = 0.608 (= 31/ 51), seq_b_name = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.30/1ba1002/1ba1002.pdb c1
RATIO TABLE : range | frequency
RATIO TABLE : --------------|--------------
RATIO RABLE : [0.9, 1.0] | 0
RATIO TABLE : [0.8, 0.9) | 0
RATIO TABLE : [0.7, 0.8) | 0
RATIO TABLE : [0.6, 0.7) | 4
RATIO TABLE : [0.5, 0.6) | 0
RATIO TABLE : [0.4, 0.5) | 0
RATIO TABLE : [0.3, 0.4) | 0
RATIO TABLE : [0.2, 0.3) | 0
RATIO TABLE : [0.1, 0.2) | 0
RATIO TABLE : [0.0, 0.1) | 0
RATIO : lcs/trimmed_seq_a = 0.673 (= 33/ 49), lcs/trimmed_seq_b = 0.717 (= 33/ 46)
SEQ A : name = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.40/1poiA02/1poiA02.pdb c1
SEQ A : residue = LPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVP
SEQ A : code = --0000RGR0RGQAABG0R00QAAAABG0RG0RGR00000OQ0G0RG0000--
SEQ A : lcs = --0000R-R0-------0-00QAAAAB-0R-0-G-00000--0G-RG0000--
SEQ B : name = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.70/1uglA00/1uglA00.pdb c1
SEQ B : residue = NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC
SEQ B : code = --00000RR00000RR0QAAAAAAHAB0R0QBG000000GRG0000R0--
SEQ B : lcs = ---0000RR0000----QAAAA----B0R0--G000000GRG0000----
// [NOTE]: A trimmed sequence is the sequence obtained by removing residues of
// irregular 5-tile codes, such as '-', where regular 5-tile codes are
// {0, A, R, Q, B, G, 1, O, H, 3, J, 8, P, 9, 2, I}. Irregular 5-tile
// codes are ommited during the LCS computation and LCSs consist of
// regular 5-tile codes only.