INPUT SEQUENCE (A) : data/seq_a.code
INPUT SEQUENCE (B) : data/seq_b.code
SUBSEQUENCE OPTION : Whole sequence comparison
EXEC OPTION : [Length only] Hirschberg's algorithm



<Frequency table of lcs/trimmed_seq_a>
RATIO TABLE :          range     |   frequency
RATIO TABLE :      --------------|--------------
RATIO RABLE :       [0.9,  1.0]  |          0
RATIO TABLE :       [0.8,  0.9)  |          0
RATIO TABLE :       [0.7,  0.8)  |          0
RATIO TABLE :       [0.6,  0.7)  |          4
RATIO TABLE :       [0.5,  0.6)  |          0
RATIO TABLE :       [0.4,  0.5)  |          0
RATIO TABLE :       [0.3,  0.4)  |          0
RATIO TABLE :       [0.2,  0.3)  |          0
RATIO TABLE :       [0.1,  0.2)  |          0
RATIO TABLE :       [0.0,  0.1)  |          0
</Frequency table of lcs/trimmed_seq_a>

 <A best target (2-th)>
RATIO :  lcs/trimmed_seq_a = 0.673 (=   33/   49), lcs/trimmed_seq_b = 0.717 (=   33/   46)
SEQ A : name    = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.40/1poiA02/1poiA02.pdb c1
SEQ A : residue = LPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVP
SEQ A : code    = --0000RGR0RGQAABG0R00QAAAABG0RG0RGR00000OQ0G0RG0000--
SEQ A : lcs     = --0000R-R0-------0-00QAAAAB-0R-0-G-00000--0G-RG0000--
SEQ B : name    = ./CATH/alpha_beta/2Layer_Sandwich/Defensin/3.30.30.70/1uglA00/1uglA00.pdb c1
SEQ B : residue = NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC
SEQ B : code    = --00000RR00000RR0QAAAAAAHAB0R0QBG000000GRG0000R0--
SEQ B : lcs     = ---0000RR0000----QAAAA----B0R0--G000000GRG0000----
 </A best target (2-th)>


// [NOTE]: A trimmed sequence is the sequence obtained by removing residues of
//         irregular 5-tile codes, such as '-', where regular 5-tile codes are
//         {0, A, R, Q, B, G, 1, O, H, 3, J, 8, P, 9, 2, I}. Irregular 5-tile
//         codes are ommited during the LCS computation and LCSs consist of
//         regular 5-tile codes only.