[Res.] TYVDPHVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYM : chn 1 [Pred] --00*000*AAAAAA0**000R000000Q0000ABRR00000QAA0000000000000QAAAAAAAAAAAHAABG00QBG00000000000000000000 : chn 1 [Accu] --99559946688443336964588746558665574679564444578766669477689887765556587888985576655776343785666677 : chn 1 [Mult] --__2___2_______22__________________________________________________________________________________ : chn 1 [Comp] --__cF_FcFFFFFFFccF__F______F____FFFF___FFFFF__________F______________F____________F___FF__F________ : chn 1 [Actu] --00RO0QB0G0000QABG000000000R00000000000QBR000000000000R00QAAAAAAAAAAAAAABG00QBG000R0001B00O00000000 : chn 1 [Res.] + ENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVM : chn 1 [Pred] + QB00QAAAAAA-0QA*0QAAAAAAAAAA00A*AAAAAB000RQG00QABG000QBR000010R*B00*0*AB00QAAAAAR000QAAAAAAAA*00AAAA : chn 1 [Accu] + 57664777988-9653557888896633543455886686976687686366756689995543335365965886578588988789999875765756 : chn 1 [Mult] + ___________-___2_______________2_______________________________2___2_2_______________________2______ : chn 1 [Comp] + ___________-_FFc____________FF_c______F________________________cF__cFc__F_____FF_F___________cFF____ : chn 1 [Actu] + QB00QAAAAAAG0RRG0QAAAAAAAAAAAAAAAAAAABR00RQG00QABG000QBR000010RR000OJQABG0QAAAB0RR00QAAAAAAAAAAAAAAA : chn 1 [Res.] + SYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSSNLLLD : chn 1 [Pred] + BRR000R0R--**AAAAAAA*00000000R00*0A*AAAAAAB0QG*0G0*0QAAAAAAAAAAAA00R*AAA**00*00-- : chn 1 [Accu] + 755889899--55877776524867888999956556599999985459936566667777667565443453486247-- : chn 1 [Mult] + _________--22_______3___________2__2__________2___3_________________2___22__2__-- : chn 1 [Comp] + __F______--cc_______cF__________cF_c__________cFFFc_______________FFc_FFccFFc__-- : chn 1 [Actu] + BR3000R0R00QAAAAAAAABR0000000R00QAAAAAAAAAB0QGQABG00QAAAAAAAAAAAA0QAAABG00O3000-- : chn 1 Statistics Success rate = 0.7256 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2GSF.code Extended success rate = 0.8014 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2GSF.code Coverage = 0.9892 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2GSF.code Mult candidate rate = 0.0758 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2GSF.code Ave. accuracy = 0.6811 : ./PDBdata/TBM/2GSF.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.