[Res.] RPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNA : chn 1
[Pred] ----**0000*R*000000000*0R00000QAAA00*ABRQBRRRQAA000***0*AAAAAAAAAAA*01RRQ0*A00*0000QB0000RAAAAAA000A : chn 1
[Accu] ----556778345945896655344689665766565669545544445882436599966556789599688535665576765885834676655635 : chn 1
[Mult] ----22____2_2_________2_____________2______________322_2___________2______3___2_____________________ : chn 1
[Comp] ----cc____c_c_F_______cFFF_FFFF___FFc_____FFFFFFFF_ccc_cFFFFFFFFFFFc_____FcFFFc__________FFFFFFF_F_F : chn 1
[Actu] --00000000RRG0R0000000RQBG0QAAAAAAAAAABRQB000OQBRG0RGR0R00RRG000RG0001RRQ80RGQB0000QB00000R00RRG0R00 : chn 1

[Res.] + AFLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIP : chn 1
[Pred] + AAA00000R*0R000000000R0*0QAB0Q0000000000R*AAAAAAAAAA**QAA*0*000000000*0-- : chn 1
[Accu] + 87566987554669865999959588856699999999695366586555463348435245677686559-- : chn 1
[Mult] + _________2_____________2_________________2__________22___2_2_________2_-- : chn 1
[Comp] + FFF______c__F__FF______c____F_F_______FF_c_______FFFcc_FFc_cF_F_FF___c_-- : chn 1
[Actu] + 0R000000R00RR00RG0000R000QABGQB0000000R1RQAAAAAAAB0000QBR00RG030RR00000-- : chn 1

Statistics
  Success rate          = 0.5030    (= #'_' / (#aa - #chn * 4))          : ./PDBdata/TBM/2GW2.code
  Extended success rate = 0.6272    (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2GW2.code
  Coverage              = 0.9882    (= (#aa - #'-') / (#aa - #chn * 4))  : ./PDBdata/TBM/2GW2.code
  Mult candidate rate   = 0.1243    (= #'*' / (#aa - #chn * 4))          : ./PDBdata/TBM/2GW2.code
  Ave. accuracy         = 0.6513                                         : ./PDBdata/TBM/2GW2.code

// Remarks
// (0) Genaral 
//     '-' means no entry in the frag_code.tbl table.
// (1) Statistics 
//     2 amino acids at both ends of chains are excluded from computation.
//     '#aa' denotes the number of all amino acids.
//     '#chn' denotes the number of all chains.
// (2) [pred] entry 
//     '*' means multiple candidates for the position.
// (3) [accu] entry 
//     Accuracy = #{occurrence of the predicted code in the conversion table} / 
//                           #{occurrence of the amino acid fragment in the table}. 
//     (In the case of multiple candidates, the occurence of one of them is considered.)
//     And 'n' means prediction accuracy is greater than or equal to n / 10.
// (4) [mult] entry 
//     '_' means single candidate.
//     'n' denotes the number of candidates.
//     'U' means the number of candidates is greater than 9.
// (5) [comp] entry 
//     '_' means successful prediction.
//     'F' means prediction failure.
//     'c' means the actual code is contained in the condidates.