[Res.] DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLKQLELLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPT : chn 1
[Pred] -------0*0*A*0A00AAAAB0**000*00R0000*000*AAA*B*0QAGQAAAAAAAAABR000**-AAAAA00*R000000A*AAA-000000R0*0 : chn 1
[Accu] -------9582459965566744245963686655546552488562556678898775443538955-86634853457888434459-9999664939 : chn 1
[Mult] -------_2_5_2__________52___2_______2___2___2_2___________________22-_______2________2___-________2_ : chn 1
[Comp] -------_cFcFc_F__FFFFF_cc___cFFFF___c___c___cFcFF_FF______F____FF_cc-FFFFF__c_FF____FcFFF-F_____F_c_ : chn 1
[Actu] --00RG000RG0O0000000000RG0000QABG0000000QAAAAAAAAAQAAAAAAAQAABRQG0QBG00000000RRG00000RRRRRG000000000 : chn 1

[Res.] + PEKNLE : chn 1
[Pred] + QAA*-- : chn 1
[Accu] + 9843-- : chn 1
[Mult] + ___2-- : chn 1
[Comp] + FFFc-- : chn 1
[Actu] + 001Q-- : chn 1

[Res.] HDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLKQLELLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYP : chn 2
[Pred] --------0*0*A*0A00AAAAB0**000*00R0000*000*AAA*B*0QAGQAAAAAAAAABR000**-AAAAA00*R000000A*AAA-000000R0Q : chn 2
[Accu] --------9582459965566744245963686655546552488562556678898775443538955-86634853457888434459-999966494 : chn 2
[Mult] --------_2_5_2__________52___2_______2___2___2_2___________________22-_______2________2___-_________ : chn 2
[Comp] --------_cFcFc_F__FFFFF_cc___cFFFF___c___c___cFcFF_FF___________FF_cc-FFFFF__c_FF____FcFFF-______F_F : chn 2
[Actu] --G00RG000RG0O0000000000RG0000QABG0000000QAAAAAAAAAQAAAAAAAAAABRQG0QBG00000000RRG00000RRR0R000000000 : chn 2

[Res.] + TP : chn 2
[Pred] + -- : chn 2
[Accu] + -- : chn 2
[Mult] + -- : chn 2
[Comp] + -- : chn 2
[Actu] + -- : chn 2

Statistics
  Success rate          = 0.4350    (= #'_' / (#aa - #chn * 4))          : ./PDBdata/TBM_FM/2H28.code
  Extended success rate = 0.5850    (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM_FM/2H28.code
  Coverage              = 0.9250    (= (#aa - #'-') / (#aa - #chn * 4))  : ./PDBdata/TBM_FM/2H28.code
  Mult candidate rate   = 0.1500    (= #'*' / (#aa - #chn * 4))          : ./PDBdata/TBM_FM/2H28.code
  Ave. accuracy         = 0.6257                                         : ./PDBdata/TBM_FM/2H28.code

// Remarks
// (0) Genaral 
//     '-' means no entry in the frag_code.tbl table.
// (1) Statistics 
//     2 amino acids at both ends of chains are excluded from computation.
//     '#aa' denotes the number of all amino acids.
//     '#chn' denotes the number of all chains.
// (2) [pred] entry 
//     '*' means multiple candidates for the position.
// (3) [accu] entry 
//     Accuracy = #{occurrence of the predicted code in the conversion table} / 
//                           #{occurrence of the amino acid fragment in the table}. 
//     (In the case of multiple candidates, the occurence of one of them is considered.)
//     And 'n' means prediction accuracy is greater than or equal to n / 10.
// (4) [mult] entry 
//     '_' means single candidate.
//     'n' denotes the number of candidates.
//     'U' means the number of candidates is greater than 9.
// (5) [comp] entry 
//     '_' means successful prediction.
//     'F' means prediction failure.
//     'c' means the actual code is contained in the condidates.