[Res.] PINVPSGLPAVKVLAKEGIFVMTEKIRPLEILILNLMPDKIKTEIQLLRLLGNTPLQVNVTLLYTETHKPKHTPIEHILKFYTTFSAVKDRKFDGFIITG : chn 1 [Pred] --R00QR00000AAAAB0000-AAAAA*A00000000QAA**AAAAAAAAAAA0QAA00000**0**0000*0**00*000*000*AAAAA00R000000 : chn 1 [Accu] --6685354554456735769-998664446664646654435577799785489885577632423699956556656564456556676666995554 : chn 1 [Mult] --___________________-_____2____________23____________________34_43____2_22__2___2___2______________ : chn 1 [Comp] --F__F__FFFF_____F___-FFFFFcF____F_F__FFcc_________FFFFFF_____cc_cc____cFccFFcFF_c__FcFFFFF_________ : chn 1 [Actu] --0000R0QAAAAAAABR000000PJ0000000R0R0QBQAAAAAAAAAAABRGRG000000000RG00000G0QAAAAG0G00QAB1QBG00R000000 : chn 1 [Res.] + APVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGIPKYELPQKLSGVYKHRVAKDSVLFRGHDDFFWAPHSRYTEVKKEDIDKVPLE : chn 1 [Pred] + 00*AAA0QAA*AA*AAAAAAA-----00***-----AAAB00000*R0R0000*000000000*A**Q*000000*AAAAA---ABA000QA*AA*00AA : chn 1 [Accu] + 562554657546656999879-----99555-----957468988369999653465778999555133565769599999---9554557845736835 : chn 1 [Mult] + __2_______2__2_______-----__222-----_________3_______2_________2_26_2______2_____---________2__2____ : chn 1 [Comp] + _FcFFF___FcFFc_______-----_Fccc-----___FFFFFFc__F____c_________cFccFcFFF_F_cFFFFF---FFF_____c__cFFFF : chn 1 [Actu] + 0RHQBG0QABGR1QAAAAAAAAAAB00GR000000QAAAAAAAA30R000000R00000000000R000QAB0R00R00000000RG000QAAAABGRJ0 : chn 1 [Res.] + ILAESDEAGVYVVANKSERQIFVTGHPEYDRYTLRDEYYRDIGRNLKVPIPANYFPNDDPTKTPILTWWSHAHLFFSNWLNYCIYQKT : chn 1 [Pred] + AAAAGQA0R00000*Q*AAA*00000QAB000000AAAA**00QAA*0000QAB----***G0QA-----A*00000------***-- : chn 1 [Accu] + 675334635678563925993855366699999554669235665548999756----5536999-----9566699------555-- : chn 1 [Mult] + ______________2_4___3__________________42_____2_______----223____-----_2_____------222-- : chn 1 [Comp] + FFFFF___F_____c_cFFFc__F___FF_FFFFF____ccFFFFFc____FFF----ccc__FF-----_cFFFFF------ccc-- : chn 1 [Actu] + 03000QA00000000QBRRG000R00QBG0QHQAAAAAAAAAABR0000000RG00RR0QBG000011QAAAAAAAAAAA00B1QB-- : chn 1 Statistics Success rate = 0.4049 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2H2W.code Extended success rate = 0.5493 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2H2W.code Coverage = 0.8979 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2H2W.code Mult candidate rate = 0.1444 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2H2W.code Ave. accuracy = 0.6523 : ./PDBdata/TBM/2H2W.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.