[Res.] ASKKVHQINVKGFFDDVEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE : chn 1 [Pred] --BGG000000A**000000*A**AAA----AAAAAAA0RRR0000000***R0000A-- : chn 1 [Accu] --9969996534234468763955999----666555577545897865233458545-- : chn 1 [Mult] --__________22______3_22___----__________________223______-- : chn 1 [Comp] --FFF______Fcc_FF___cFccFFF----F______FF_F_______cccF___FF-- : chn 1 [Actu] --00000000000003O000000R0000000QAAAAAAG0RG00000000000000R0-- : chn 1 [Res.] ASKKVHQINVKGFFDDVEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE : chn 2 [Pred] --BGG000000A**000000*A**AAA----AAAAAAA0RRR0000000***R0000A-- : chn 2 [Accu] --9969996534234468763955999----666555577545897865233458545-- : chn 2 [Mult] --__________22______3_22___----__________________223______-- : chn 2 [Comp] --FFF______Fcc_FF___cFccFFF----F______FFFF_______cccF___FF-- : chn 2 [Actu] --00000000000003O000000R0000000QAAAAAAG00G00000000000000R0-- : chn 2 [Res.] ASKKVHQINVKGFFDDVEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE : chn 3 [Pred] --BGG000000A**000000*A**AAA----AAAAAAA0RRR0000000***R0000A-- : chn 3 [Accu] --9969996534234468763955999----666555577545897865233458545-- : chn 3 [Mult] --__________22______3_22___----__________________223______-- : chn 3 [Comp] --FFF______Fcc_FF___cFccFFF----F______FFFF_______cccF___FF-- : chn 3 [Actu] --00000000000003O000000R0000000QAAAAAAG00G00000000000000R0-- : chn 3 [Res.] ASKKVHQINVKGFFDDVEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE : chn 4 [Pred] --BGG000000A**000000*A**AAA----AAAAAAA0RRR0000000***R0000A-- : chn 4 [Accu] --9969996534234468763955999----666555577545897865233458545-- : chn 4 [Mult] --__________22______3_22___----__________________223______-- : chn 4 [Comp] --FFF______Fcc_FF___cFccFFF----F______FF_F_______cccF___FF-- : chn 4 [Actu] --00000000000003O000000QG000000QAAAAAA80RG00000000000000R0-- : chn 4 Statistics Success rate = 0.4732 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/FM/2H4O.code Extended success rate = 0.6161 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/FM/2H4O.code Coverage = 0.9286 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/FM/2H4O.code Mult candidate rate = 0.1429 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/FM/2H4O.code Ave. accuracy = 0.6292 : ./PDBdata/FM/2H4O.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.