[Res.] NIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAEN : chn 1 [Pred] --0000000000QABRR00AAAA00000QG0GQ*A**AARRG0000000*000RA**AB****00*0000*AQB000000000000RR0QAAA00*0*B0 : chn 1 [Accu] --66655788764335876875657886347465655663659766676248969559655559737556399699889999999987568665635347 : chn 1 [Mult] --_______________________________2_22____________2_____22__2222__3____3________________________2_2__ : chn 1 [Comp] --_____________FF_F_FFF_F___FF_FFcFccFF_________Fc___FFccFFccccFFcFFFFc_F______________________c_c__ : chn 1 [Actu] --0000000000QAB000QAB000G000R00QBG00000RRG000000R0000QBG0QAAAAABHQAAAAAAAB000000000000RR0QAAA0000QB0 : chn 1 [Res.] + PGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHS : chn 1 [Pred] + 0R0R0AAAAAAAAA****A----0*0000*AA000RAAAAAB0*00AAAA00000QBR00000000000R00000A*QA00*0**0*R***AAAAAAAAA : chn 1 [Accu] + 6676469887555535559----95685636557435588635269875445467676479999764646899999355433655959553655666677 : chn 1 [Mult] + ______________3222_----_2____2_____________3________________________________2____3_22_2_223_________ : chn 1 [Comp] + _FFFF_________ccccF----_c____cFF__F_FFFFF_Fc_FFFFF________FF_____F___F____F_cF_FFcFccFcFcccFFFFFFFFF : chn 1 [Actu] + 00QAAAAAAAAAAAAABG0QBG000000000000RRG000QBG00O000000000QBRRR00000R00000000QAAAAAAAAAAAAAB00QB0RG0RGQ : chn 1 [Res.] + SRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEK : chn 1 [Pred] + ABG000000000R0*R**R00RR*000000000R0000AAAAAAAAAAQAAAAAA**AAAAAA*A---**AB0QAAAABQAAA0*R00000000000000 : chn 1 [Accu] + 85987989976455562355743437666366753457688985865356776443467766439---33566688684564353355899687888699 : chn 1 [Mult] + ______________2_32_____2_______________________________22______3_---32______________2_______________ : chn 1 [Comp] + ____________F_cFcc___FFc_____F_______FF_________F______cc_____FcF---cc________F___FFc___________FFFF : chn 1 [Actu] + ABG00000000000RQB0R0000000000R000R0003QAAAAAAAAAAAAAAAAAAAAAAABR0RG0RQAB0QAAAAJQAAJG0R0000000000RGQA : chn 1 [Res.] + NTSETLYSLKFAERVR : chn 1 [Pred] + R00*AAAA*0AAAA-- : chn 1 [Accu] + 68926576365554-- : chn 1 [Mult] + ___4____2_____-- : chn 1 [Comp] + FFFc____cF____-- : chn 1 [Actu] + GQAAAAAAAAAAAA-- : chn 1 Statistics Success rate = 0.5705 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2H58.code Extended success rate = 0.7019 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2H58.code Coverage = 0.9776 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2H58.code Mult candidate rate = 0.1314 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2H58.code Ave. accuracy = 0.6457 : ./PDBdata/TBM/2H58.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.