[Res.] AHPPQIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFRVIGSPDPYAAHIDGGGATSSTSKCVILSKSSQPGHDVDYLYGQVSIDKPFVDWSGN : chn 1 [Pred] --ORG0000QA0000R0*BR00Q0*A000**000000*AAAAA*000000*1*A*0*0RR000*BR*R**AAA0R000**000*0000000G000**000 : chn 1 [Accu] --99699994553499946566654446523898986345675459579755454435437564695925776647965599959898885485655999 : chn 1 [Mult] --_______________2______2____22______2_____2______2_2_2_2______2__2_42________22___2___________22___ : chn 1 [Comp] --FFF____FF____FFcFF__F_c_FF_ccFFF__Fc_____cFFF_F_cFcFcFc_F_FFFcF_cFccFFF__F_Fcc___c_____F__FF_ccFF_ : chn 1 [Actu] --00000000000000RG000000QABG0QAABG00QAAAAAAAABR0O0QBRGRQB00RRGQAHR00000000RG0RGO000000000R0GRG00RRG0 : chn 1 [Res.] + CGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVPVSGGQVQETGDFELDGVTFPAAEIVLEFLDPSDGGAIFPTGNLVDDLEVPGVG : chn 1 [Pred] + 0*R00000000*00R00R0QAA*R*R****000*****RG00000000000AAAA0**00000*00*0AAAAAA*00QABRR000000000A00000*G0 : chn 1 [Accu] + 9455544334456536435983352555536753555245778999873536664633886333565556566625874358359674364734498347 : chn 1 [Mult] + _2_________2__________2_4_2223___32225__________________22_____2__2_______2______________________2__ : chn 1 [Comp] + _cFFFFFFFFFcFFFFFF___FcFcFcccc___ccccc_F____F____FFFFFFFcc____FcF_c_FFFFFFc_FFFFFF_FFFFFFF_FF____c__ : chn 1 [Actu] + 0QAAAAAAAAAAAABRRG0QABG0R000000000RQB0R00000R0000RRG0R0G000000RGR00000000000R013000RGQBRGR00R0000QG0 : chn 1 [Res.] + TFKATINAGIPTVFVNAEEIGYRGTELREEINGDPQQLARFERIRVAGALRGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSG : chn 1 [Pred] + 00000A*BR000000*AAAAR0R00AAAAAA**0QAAAAA*AA0AAAAAA0R*0*0QAAAA*AA000RAAAAA00*0*A*0BRG00000000AAAAAA*R : chn 1 [Accu] + 4588755658967692599546645556876556988575556555556344463998876554697645666695625332535453456435556435 : chn 1 [Mult] + ______2________4_______________22_______2___________2_2______2_____________2_4_2__________________2_ : chn 1 [Comp] + _____FcF_______cF__FF__FFFFF_FFccF______c__F______FFc_c______cFFFFFFFFFFF__c_cFcF_FF___FFFFFFFFFFFc_ : chn 1 [Actu] + 00000000R0000000QAAB00RQB00QAB1QBGQAAAAAAAAAAAAAAAB2R0R0QAAAAAGQJGO0000000000000QB00000QABGR000000OR : chn 1 [Res.] + KLHHAGTAAVAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAISRSARILEGWVRVPGDAF : chn 1 [Pred] + *00B00AAAAA000AAAA0R*A*AA00000*0AAA*0*-0R000000*AA*AA000000B*A*0QAAAAAA*A000000-- : chn 1 [Accu] + 38995355665664465475365454555534655265-6457766424444356688795636354777535999869-- : chn 1 [Mult] + 2___________________2_2_______2____4_2-________2__2_________2_2________2_______-- : chn 1 [Comp] + c__FFFF____FFF__FF__cFc__FFF__c_FFFc_c-FF______cFFcFFFFF___FcFc_FFFFFFFcF____FF-- : chn 1 [Actu] + G00RPGQAAAAAAAAABG0R0QAAAAB30000R000000R0000000000000RRG000R000000000O0000000QA-- : chn 1 Statistics Success rate = 0.3899 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2H9F.code Extended success rate = 0.5517 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2H9F.code Coverage = 0.9973 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2H9F.code Mult candidate rate = 0.1618 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2H9F.code Ave. accuracy = 0.6031 : ./PDBdata/TBM/2H9F.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.