[Res.] LGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYC : chn 1 [Pred] --G00000000*AAAAA00*0RR000100000000000000*000QAAAAR00000AA-AAAA0000AAAAAAAAAR*R0R000000*-AAAAAAQA*-* : chn 1 [Accu] --46754577644664577346566669999654899666449996669996668455-56555686568888966659677777755-956533865-5 : chn 1 [Mult] --_________2_______2_____________________2________________-__________________2_________2-________2-2 : chn 1 [Comp] --F___FF___cFFFFFFFcFFFFFFFFFFFF_F____F_FcFFFFF___FFFFFF_F-FFFF___F_FF______FcFF_______c-FFFFFF__c-c : chn 1 [Actu] --0000RG000RQBG0GQAAAAAAAAAAAABR0R0000R0QAAABGQAAAAABRRQAB0G000000QABQAAAAAAAAABR000000000QB000QABG0 : chn 1 [Res.] + FPEKSLLLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLS : chn 1 [Pred] + *QAAA00000*R*B0000AAAAAB0AAAA*00**AA000A0AA*00000AA--AAAA-- : chn 1 [Accu] + 554444556423256885469966699655744444654545333445899--9999-- : chn 1 [Mult] + 2_________2_2________________2__22_________2_______--____-- : chn 1 [Comp] + cFFFF_____c_cF___F____FFFFFFFc__ccFF___FF__cFFFFF__--____-- : chn 1 [Actu] + 00QB0000000R00000QAAAABGR00000000GRG0000QAAAAAAAAAAAAAAAA-- : chn 1 [Res.] RLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCISDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEKSL : chn 2 [Pred] --000*AAAAA00*0RR000100000000000000*000QAAAAR00000AA-AAAA0000AAAAAAAAAR*R0R000000*-AAAAAAQA*-**QAAA0 : chn 2 [Accu] --87644664577346566669999654899666449996669996668455-56555686568888966659677777755-956533865-5554444 : chn 2 [Mult] --___2_______2_____________________2________________-__________________2_________2-________2-22_____ : chn 2 [Comp] --___cFFFFFFFcFFFFFFFFFFFF_F____F_FcFFFFF___FFFFFF_F-FFFF___F_FF______FcFFF_____Fc-FFFFFF__c-ccFFFF_ : chn 2 [Actu] --000RQBG0GQAAAAAAAAAAAABR0R0000R0QAAABGQAAAAABRRQAB0G000000QABQAAAAAAAAAB000000RG00QB000QABG000QB00 : chn 2 [Res.] + LLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLSH : chn 2 [Pred] + 0000*R*B0000AAAAAB0AAAA*00**AA000A0AA*00000AA--AAAAA-- : chn 2 [Accu] + 556423256885469966699655744444654545333445899--99666-- : chn 2 [Mult] + ____2_2________________2__22_________2_______--_____-- : chn 2 [Comp] + ____c_cF___F____FFFFFFFc__ccFFF__FF__cFFFFF__--_____-- : chn 2 [Actu] + 00000R00000QAAAABGR00000000GRGO000QAAAAAAAAAAAAAAAAA-- : chn 2 Statistics Success rate = 0.3836 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HA8.code Extended success rate = 0.4754 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HA8.code Coverage = 0.9672 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HA8.code Mult candidate rate = 0.0918 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HA8.code Ave. accuracy = 0.6460 : ./PDBdata/TBM/2HA8.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.