[Res.] NPREQLGVCAEGNLHSVYLFNANDNVESQLRPCIANVAQYIYELTDQYSDSAFNGFVAIGANYWDSLYPESRPELKPFPAQEGNREAPAIEYDLFVHLRC : chn 1 [Pred] --*AAAR000BR00*0R*000Q**00AAAAA-AAAAAA*AAAA*0*********000A00***-AB00Q00GQA*Q0*O*A00*QAAAA*AAA**00000 : chn 1 [Accu] --35645874588637545566536656676-9566565969745555553353776444225-645555678524659595325567756854459999 : chn 1 [Mult] --2___________2__2____23_______-______2____2_222223323______352-__________5__2_2___3_____2___22_____ : chn 1 [Comp] --cFFFFF__FF_Fc_Fc___FccFFF_F__-______c____cFccccccccc___F__ccc-_FF__F_FFFcF_cFcF__cFFFFFcFFFcc_____ : chn 1 [Actu] --0001QB00000R0000000000RRQA2AAAAAAAAAAAAAAAAAABQA8R00000000QAAQAAB0QB000OG000R0000RG0O00000R0000000 : chn 1 [Res.] + DRYDILHLVANEISQFEDLVELVEEERGFRFDSRDLTGFVDGTENPKGRHRQEVALVGSEDPEFKGGSYIHVQKYAHNLSKWHRLPLKKQEDIIGRTKQD : chn 1 [Pred] + 0*0R000000AB**AAAAAAAAAAAA0*0000*AAAAAA*BR***QAA*0-A000000000Q***00***AAAG**00QB000000AAAAAA00R*0*00 : chn 1 [Accu] + 95997775655435876545655585548868454434443533356659-9967785554435599555999935655469966635558545638266 : chn 1 [Mult] + _2__________32_____________2____2______2__222___2_-___________222__222____32___________________3_4__ : chn 1 [Comp] + FcFFFFFFFF_FccFFFFFFFFFFFF_c__FFcFFFFFFcF_cccFFFcF-_FF_F__FF__cccFFcccFFFFcc_F_FFFFFF_F_____FF_c_c_F : chn 1 [Actu] + RGQAAAAAAAAAAABR0RR00000000000O3R00QBRG00RQB0000QAAAAB0G00QB0QAB1RG0000000000RQAAAABG0QAAAAAABRG000R : chn 1 [Res.] + NIEYESEDKPLTSHIKRVNLKDENGKSIEILRQSPYGSLKEQGLFISTCRTPDHFEKLHSVFGDGAGNHDHLHFTSALTGSSFFAPSLDFLQFDN : chn 1 [Pred] + R*0000*R0000AA*A000Q00QBR000AAAABGQB*AAAABR00000*00QAA-AAAAAA000000QAAAB**0000000000000AAAAA--- : chn 1 [Accu] + 659999366776595568633356868555784796367886789976599999-9966755858999999843654355556697437589--- : chn 1 [Mult] + _2____3_______2_____________________2___________2_____-_________________22__________________--- : chn 1 [Comp] + _c___FcF__FFFFc_FFFF_______FFFFFFFFFcFFFFFF_____cF____-______F_FFF_FFFFFcc___F_________F__FF--- : chn 1 [Actu] + R0000QAB00QBGQAAA1G000QBR00R0000R13000QB000000000R0QAAAAAAAAAB0RQB0000RRRG000R000000000QAA8J0-- : chn 1 Statistics Success rate = 0.3574 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HAG.code Extended success rate = 0.5395 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HAG.code Coverage = 0.9828 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HAG.code Mult candidate rate = 0.1821 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HAG.code Ave. accuracy = 0.6351 : ./PDBdata/TBM/2HAG.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.