[Res.] SRTLVLFDIDGTLLKVESNRRVLADALIEVYGTEGSTDFSGKDGAIIYEVLSNVGLERAEIADKFDKAKETYIALFRERARREDITLLEGVRELLDALSS : chn 1 [Pred] --A0000R00RG000000R**0AAAAAA*0000Q*0000000*RG000AAAAA0AAAAAAAAAA*AAAAAAAAABAAAAAAAQ**000AAAAAAAAAAAQ : chn 1 [Accu] --86657563557586579335455665489874358887433547584577653456777666258778899859688973323765435887988733 : chn 1 [Mult] --_________________22_______2_____2_______2_____________________3__________________22_______________ : chn 1 [Comp] --F____F__F_F____FFccF______c_FFFFcFFFF_FFcFFFFF_____FFFFF_____Fc_________F__FFFFFFcc___FFF________F : chn 1 [Actu] --00000000QGR0000OQAAAAAAAAAB0ORGR0313R0RG2QAAAAAAAAAB000QAAAAABQAAAAAAAAAAAAB000QABG0000RQAAAAAAAAB : chn 1 [Res.] + RSDVLLGLLTGNFEASGRHKLKLPGIDHYFPFGAFADDALDRNELPHIALERARRTGANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTEELARH : chn 1 [Pred] + AAAAAAAAAA**000**AAA**00A*A*00**0RG**AAA*QAA**BAAAAAAAA***000QAAA000000*G***A00000*A*00000RR00AAAAAA : chn 1 [Accu] + 4444655574336675566423544275995595432434445544657787773322469697778888439535955334363565544334688986 : chn 1 [Mult] + __________22___22___22___2_2__22___23___2___22_________332_____________3_232______2_2_______________ : chn 1 [Comp] + FFFFFFFFFFcc_FFcc___ccFFFcFcFFcc_FFccFFFc___ccF________cccF____FF______cFccc_FFFFFcFc___FFF_F_F____F : chn 1 [Actu] + GQBG000000RG0QAAAAAAAAAB0QQABGR0000QAG0RGQAAHAAAAAAAAAAJR0R00QABG000000QAAAAAAAABR000000RRGRG0QAAAAB : chn 1 [Res.] + KPGTLFKNFAETDEVLASILT : chn 1 [Pred] + *0R00**0*A*0AAAAAAA-- : chn 1 [Accu] + 4675344324464777656-- : chn 1 [Mult] + 2____22_3_2________-- : chn 1 [Comp] + c____cc_cFcF_______-- : chn 1 [Actu] + 00R000R0RQJQAAAAAAA-- : chn 1 Statistics Success rate = 0.4562 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HCF.code Extended success rate = 0.6267 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HCF.code Coverage = 1.0000 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HCF.code Mult candidate rate = 0.1705 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HCF.code Ave. accuracy = 0.5955 : ./PDBdata/TBM/2HCF.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.