[Res.] QPLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRGFAESSLRVGDVDSFDFSSVGLAFFAAAAEVSRAHAERARAAGCSVIDLSGALEPS : chn 1 [Pred] --*G0000000000A*AA00000QBB0***AAA*AA0*AA00*A**AAA000000G0000B00000AAAAAAAAAAAAAAAAAAAB00*000R0RQ00Q* : chn 1 [Accu] --34788775687333453334686493356665436244355655555447634568983455654547776766988777777546567733232634 : chn 1 [Mult] --3____________2___________332___2___2____2_22__________________________________________2__________2 : chn 1 [Comp] --cF____FFFFFF_c__FFFFFF_F_cccFFFcFF_c_F_FcFccFFF______FFF__FFFFF_FFFFFFF____FFF______F_c___FF__F_Fc : chn 1 [Actu] --000000RQBGQAAAAAAAAAAABR0R000000000QAB0RG000RRG000000QAB00QABGR0000RG0QAAAAB1QAAAAABR00000QBRQB0O1 : chn 1 [Res.] + VAPPVVSVNAERLASQAAPFLLSSPCAVAAELCEVLAPLLATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAV : chn 1 [Pred] + 00*00000*AAAAAAAAA*B*A*0AAAAAAAAAAAA00AAAAARAA*000RR00000000ABR0AAAAAAAAAAAAA0000000*AG*0AAAAAAAA000 : chn 1 [Accu] + 5938688833776765542434354688999666535556656499366775878744454344587876767785248785454465666777984376 : chn 1 [Mult] + __3_____2_________3_2_2_______________________3_____________________________________2__2____________ : chn 1 [Comp] + F_c__FF_cF____FFFFcFcFc_FFF_________FF__FFFFFFc___FF___FFFF_FFFF___________FF_____FFcF_cFFFFFFFFF___ : chn 1 [Actu] + R00002R00QAAAAGG01R0000000QAAAAAAAAAAAAAB0G30R000000000QAAB0QAAAAAAAAAAAAAABR000001R0RG0RGRG00R00000 : chn 1 [Res.] + DAEGHSAIERRIFAEVQALLGERIGPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKGIEWVGEGDYPTVVGDALGQDETYVGRVRAGQADP : chn 1 [Pred] + 0QAR00AAAAAAAAAAAAA*AA000000*0Q*0**0000000000000Q*0AAAAAAAA000QA*R00*000RG0*0000RA00Q0***0AA**0RG0-- : chn 1 [Accu] + 86366546887865555764334466553995955676645587899944666566566544343678368976936864333445323645553656-- : chn 1 [Mult] + ___________________2________3__2_22______________2______________2___3______3__________223___22____-- : chn 1 [Comp] + __F___F___________FcFFFF____c_Fc_ccF____________Fc_FFF_____FFFFFc_F_c_FF___c_FFFFFFFF_ccc_FFcc_FF_-- : chn 1 [Actu] + 0QBR00QAAAAAAAAAAAGR0QBG0000000000RG000000000000R000RQAAAAAAAABG0RG0001RRG000QAB00GRG0G0001R0000R00Q : chn 1 [Res.] + CQVNLWIVSDNVRKGAALNAVLLGELLIKHYL : chn 1 [Pred] + --****0BGA00*A0*A0000000AAA*A0-- : chn 1 [Accu] + --5553744455444444546545457559-- : chn 1 [Mult] + --2223______2__2___________2__-- : chn 1 [Comp] + --cccc_FFFFFcFFcFFFFFFFF___cFF-- : chn 1 [Actu] + BG0000000OQGR1R01AAAAAAAAAAAG1-- : chn 1 Statistics Success rate = 0.4268 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HJS.code Extended success rate = 0.5518 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HJS.code Coverage = 0.9878 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HJS.code Mult candidate rate = 0.1250 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HJS.code Ave. accuracy = 0.5927 : ./PDBdata/TBM/2HJS.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.