[Res.] YFQGTASIFSGVIPALTPCRQDRTPDFDALVRKGKELIADGSAVVYCGSGDWPLLTDEQREGVERLVKAGIPVIVGTGAVNTASAVAHAVHAQKVGAKGL : chn 1 [Pred] --000Q*A000*00A000*0-----0QAAAAA0*0*00ABR0000*000000*A00QAAA0R0AAAAABR0000000R0000AAAAAAAAAAAA000000 : chn 1 [Accu] --969635555364338659-----468766533235543546454569965344668856444666646898976464574557988997543435456 : chn 1 [Mult] --____3____2______2_-----________2_2_________2______2_______________________________________________ : chn 1 [Comp] --FFFFcFFF_c__F___c_-----F______FcFcFF__F____cF_FFFFcFF_____FFF_____________FF_F_F____________F__F__ : chn 1 [Actu] --BPG00QBG0000R00000QBR00RQAAAAAAAAAAAAB000000O0RRRQABG0QAAAAAAAAAAABR000000R00R0QAAAAAAAAAAAAB00R00 : chn 1 [Res.] + VIPRVLSRGSVIAAQKAHFKAILSAAPEIPAVIYNSPYYGFATRADLFFALRAEHKNLVGFKEFGGPADRYAAENITSRDDEVTLIGVDTAVVHGFVNCG : chn 1 [Pred] + 000AA00*000AAA**0AAAAAAAA00AA0000R*GQAB0QAAAAAAA*AAAAAB0R0QA0AA*R0QAAAAAAA**000**00000000*00000**G** : chn 1 [Accu] + 8663344254644322355677664356579886376867665655555666566568344564447433456633599345554775334665453643 : chn 1 [Mult] + _______3______32__________________2_____________2______________2__________22___32________2_____23_22 : chn 1 [Comp] + ___FFFFcFFFF__ccF_______F_FFF____FcF___FFFFFF___c____FFFFFFF_FFcF___FF___FccFF_ccFF_F___FcFFFFFccFcc : chn 1 [Actu] + 00000RGRQBGQAAAAAAAAAAAAB0QBG0000000QABRG000QAAAAAAAABGQBR00000RG0QABQAAAB001G0RGRG01000QAG1AAAB000R : chn 1 [Res.] + ATGAITGIGNVLPKEVIHLCKLSQAAAKGDADARARALELEQALAVLSSFDEGPDLVLYFKYVLKGDKEYTLHFNETDALTDSQRGYVEAQFKLFNSWYA : chn 1 [Pred] + 000A00**0*000QAAA---A00AAAABR0*AAAAAAAAAAAAAAAA00*0R0QB0000AA000000QA000000**AAA0QAAA0AAAAA000*AB*00 : chn 1 [Accu] + 55535532547875768---94447663444689897664767666535233542558696588764545579874357554684456686564265599 : chn 1 [Mult] + ______22_2_______---__________2__________________4_________________________23_________________2__2__ : chn 1 [Comp] + _F_F__ccFc__FF___---_FF_______c____________FF__FFcFFF__FFFF_FFFFFFF__FFF_FFccFFF_____F_____FFFc_FcFF : chn 1 [Actu] + 0R0000QAAB00QAAAAAAAAAAAAAABR0QAAAAAAAAAAAABPAAAAAABGQBQAAAABO3QBRRQABRG0QGQBG000QAAAAAAAAAAAAAAAAAA : chn 1 [Res.] + DWSK : chn 1 [Pred] + **-- : chn 1 [Accu] + 55-- : chn 1 [Mult] + 22-- : chn 1 [Comp] + cc-- : chn 1 [Actu] + AA-- : chn 1 Statistics Success rate = 0.4767 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HMC.code Extended success rate = 0.5867 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HMC.code Coverage = 0.9733 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HMC.code Mult candidate rate = 0.1100 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HMC.code Ave. accuracy = 0.5836 : ./PDBdata/TBM/2HMC.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.