[Res.] NPENWLLLRRVVRFGDTDAAGVHFHQLFRWCHESWEESLESYGLNPADIFPGSRKSEVTPEVALPIIHCQADFRRPIHTGDALAELRPERLNPNSFQVHF : chn 1
[Pred] --***AAAAAA*0*R0GRABR000A00QA------**0*AA0000QAAA00***AA000Q*00G000R--AAAA*0**G*AAAAAAAQAAA0QB*000-- : chn 1
[Accu] --555785446565643333464999999------535246566878534645594468445659699--9999595552476877466658663799-- : chn 1
[Mult] --222______2_2_______________------22_3____________222______2_______--____2_22_2______________2___-- : chn 1
[Comp] --ccc_FFFFFc_cFF_FF__FFF_FFF_------ccFc__F_____FF_FcccFFF__FcF_F__FF--FFFFc_ccFcFFFFFFFFFFF__Fc___-- : chn 1
[Actu] --AB1AG000000QABG0QBR831AAAAAAAAAAAAAAAAAB000QAB001R0Q00R000RG0000R000000000000R0000000000R0QG000000 : chn 1

[Res.] + EFRCEEQIAAHALIRHLAINAQTRHRCALPEGIDRWLEASG : chn 1
[Pred] + ---AQAAAAAAAAAAAA00R*****A*0000**AAAA*0-- : chn 1
[Accu] + ---989987867688645453535595778444779545-- : chn 1
[Mult] + ---_________________32322_2____22____2_-- : chn 1
[Comp] + ---FFFFFFFFFFFFFF__FcccccFc___Fcc____cF-- : chn 1
[Actu] + 0000RRG0R00000000000Q0BR000000QAAAAAAAA-- : chn 1

Statistics
  Success rate          = 0.2555    (= #'_' / (#aa - #chn * 4))          : ./PDBdata/TBM/2HX5.code
  Extended success rate = 0.4453    (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HX5.code
  Coverage              = 0.9051    (= (#aa - #'-') / (#aa - #chn * 4))  : ./PDBdata/TBM/2HX5.code
  Mult candidate rate   = 0.1898    (= #'*' / (#aa - #chn * 4))          : ./PDBdata/TBM/2HX5.code
  Ave. accuracy         = 0.6422                                         : ./PDBdata/TBM/2HX5.code

// Remarks
// (0) Genaral 
//     '-' means no entry in the frag_code.tbl table.
// (1) Statistics 
//     2 amino acids at both ends of chains are excluded from computation.
//     '#aa' denotes the number of all amino acids.
//     '#chn' denotes the number of all chains.
// (2) [pred] entry 
//     '*' means multiple candidates for the position.
// (3) [accu] entry 
//     Accuracy = #{occurrence of the predicted code in the conversion table} / 
//                           #{occurrence of the amino acid fragment in the table}. 
//     (In the case of multiple candidates, the occurence of one of them is considered.)
//     And 'n' means prediction accuracy is greater than or equal to n / 10.
// (4) [mult] entry 
//     '_' means single candidate.
//     'n' denotes the number of candidates.
//     'U' means the number of candidates is greater than 9.
// (5) [comp] entry 
//     '_' means successful prediction.
//     'F' means prediction failure.
//     'c' means the actual code is contained in the condidates.