[Res.] EESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKNKSNLNSLDEQEGVKSGYVVIEVKVATQ : chn 1 [Pred] --AA*000000AAAAAABR**0*0---G**AAAA00*00QGR0R0*00*0-0A0*AAAA000R*000----AB0**AAA00Q**R*A*000000000000 : chn 1 [Accu] --9656889554766557734639---95566565556594452435434-9653665999564899----99953574454237243579899969699 : chn 1 [Mult] --__2______________22_3_---_22______2________2__2_-___2________2___----___23______53_5_2____________ : chn 1 [Comp] --FFc___F_F_FFF__FFcc_cF---FccFFFFFFc__FFF__Fc__cF-FF_cFFFF____c___----FFFccF__FFFcc_c_cFF_________F : chn 1 [Actu] --G00000R0QABGQAAAABQ0QB0000000000RG0000000RR000QB0RG000000000RG000000013QABQAAAAAABRQAB13000000000Q : chn 1 [Res.] + EGKEITCRSYLTNYESAPPSPQYKKIICGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKK : chn 1 [Pred] + 0R0000000**R00G00000QAAAAAA1*AA0RR00QA**AAAAAAA*R**RR*000AAAAAA-- : chn 1 [Accu] + 665788767535554459999999888956664569555567778885933642683555768-- : chn 1 [Mult] + _________23_________________2_________22_______2_33__2_________-- : chn 1 [Comp] + F________ccF__F____________Fc__FFF____cc____FFFcFcc_Fc__F______-- : chn 1 [Actu] + BR000000000000000000QAAAAAAAAAAAB000QAAAAAAABG00030RG000QAAAAAA-- : chn 1 [Res.] ESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVWGVVWKNKSNLNSLDEQEGVKSGYVVIEVKVATQE : chn 2 [Pred] --*R000000AAAAAABR**0*0---G**AAAA00*00QGR0R0*00*0-0A0*AAAA000R*000----AB0**AAA00Q**R*A*0000000000000 : chn 2 [Accu] --566889554766557734639---95566565556594452435434-9653665999564899----999535744542372435798999696996 : chn 2 [Mult] --2_______________22_3_---_22______2________2__2_-___2________2___----___23______53_5_2_____________ : chn 2 [Comp] --cF_____F_FFF__FFccFcF---FccFFFFFFc__FFF__Fc__cF-FF_cFFFF____c___----FFFccF__FFFcc_c_cFF_________FF : chn 2 [Actu] --0000000QABGQAAAABQGQB0000000000RG0000000RR000QB0RG000000000RG000000013QABQAAAAAABRQAB13000000000QB : chn 2 [Res.] + GKEITCRSYLTNYESAPPSPQYKKIICGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKG : chn 2 [Pred] + R0000000**R00G00000QAAAAAA1*AA0RR00QA**AAAAAAA*R**RR*000AAAAAAA-- : chn 2 [Accu] + 657887675355544599999998889566645695555677788859336426835557685-- : chn 2 [Mult] + ________23_________________2_________22_______2_33__2__________-- : chn 2 [Comp] + ________ccF__F____________Fc__FF_____cc____FFFcFcc_Fc__F_______-- : chn 2 [Actu] + R000000000000000000QAAAAAAAAAAABR00QAAAAAAAB0000R0RG000QAAAAAAA-- : chn 2 Statistics Success rate = 0.4783 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2I5T.code Extended success rate = 0.6398 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2I5T.code Coverage = 0.9503 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2I5T.code Mult candidate rate = 0.1615 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2I5T.code Ave. accuracy = 0.6512 : ./PDBdata/TBM/2I5T.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.