[Res.] KLDLHQTTQDLVALFAKVTVEQDDALLGNQISRFNRLFGVAEIADELKARDGDQRTALLSLFEYPNQVRLQAAKLTLAVAPVKAREQLEAIVSSKWFPQA : chn 1 [Pred] --AAAAA*AAAAAAA*00000*0AAA**RA*AAA00000*AAAAAAAAAB0*-**AAAAAA00G0R*0AAAAAA0000000AAAAAAAAAAA***-0**0 : chn 1 [Accu] --89988566677663789864537633695999568863567577765345-534777853666749688754554566345678887665423-9557 : chn 1 [Mult] --_____2_______2_____2____22__2________2___________2-23___________2_________________________223-_22_ : chn 1 [Comp] --FFFFFc_______cFFFFFcF___cc_Fc___FFFFFc________FF_c-cc______FFFFFcF______FFFFF_F___________ccc-_ccF : chn 1 [Actu] --0RR80QAAAAAAAAAAAAAAAAAAABRRQAAAAAAAAAAAAAAAAABG0RRQQAAAAAAQB0R0QAAAAAAAABQAB0QAAAAAAAAAAAABR00PAA : chn 1 [Res.] + GDAGCLDLLDDGTFKPK : chn 1 [Pred] + RGQA*AAAAQBR000-- : chn 1 [Accu] + 555555543356589-- : chn 1 [Mult] + ____2__________-- : chn 1 [Comp] + FFF_c____F_FFF_-- : chn 1 [Actu] + AAAAAAAAAABQRG0-- : chn 1 Statistics Success rate = 0.4867 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM_FM/2I9C.code Extended success rate = 0.6372 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM_FM/2I9C.code Coverage = 0.9823 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM_FM/2I9C.code Mult candidate rate = 0.1504 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM_FM/2I9C.code Ave. accuracy = 0.6380 : ./PDBdata/TBM_FM/2I9C.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.