[Res.] TTPPARTAKQRIQDTLNRLELDVDAWVSTAGADGGAPYLVPLSYLWDGETFLVATPAASPTGRNLSETGRVRLGIGPTRDLVLVEGTALPLEPAGLPDGV : chn 1 [Pred] --**AAA******AAAR00000QA**000000RRR0000AAAAA-A***AAA*00Q*00*0R00Q0Q000000000**0R000000AAA0QA*0000*00 : chn 1 [Accu] --557563455349554445864445686584446699566669-9532646357533635545333457966557234457765445553642755378 : chn 1 [Mult] --22___322232___________22__________________-_222___2___2__2________________32______________2____2__ : chn 1 [Comp] --ccFFFcccccc___FFFFFFFFcc_____FFF_F___FFFFF-FcccFFFc__FcFFcFFFFFFF_FF______ccFF______FFF_FFcFF__cFF : chn 1 [Actu] --00000QAAAAAAAAAAABGGR00O00000Q80RG0000000000RRG0000000QBGQAAAAAAB0RG00000000QB000000000000QAJ000RQ : chn 1 [Res.] + GDTFAEKTGFDPRRLTTSYLYFRISPRRVQAWREANELSGRELRDGEWLVTD : chn 1 [Pred] + 0**AAAA**0000000AAAA-0**0*AAAA*AB*AAA*0*0000*RA**0-- : chn 1 [Accu] + 84357863369969855669-95562566659936563633555254336-- : chn 1 [Mult] + _22____22___________-_22_4____2__3___2_2____2__33_-- : chn 1 [Comp] + Fcc___FccF_FFFFFFFFF-_cc_cFFFFcFFcF__cFcFFF_c_Fcc_-- : chn 1 [Actu] + AAAAAAB0RG0QABGRG000000000O0000000QAARGRRGO0RRG000-- : chn 1 [Res.] TTPPARTAKQRIQDTLNRLELDVDAWVSTAGADGGAPYLVPLSYLWDGETFLVATPAASPTGRNLSETGRVRLGIGPTRDLVLVEGTALPLEPAGLPDGV : chn 2 [Pred] --**AAA******AAAR00000QA**000000RRR0000AAAAA-A***AAA*00Q*00*0R00Q0Q000000000**0R000000AAA0QA*0000*00 : chn 2 [Accu] --557563455349554445864445686584446699566669-9532646357533635545333457966557234457765445553642755378 : chn 2 [Mult] --22___322232___________22__________________-_222___2___2__2________________32______________2____2__ : chn 2 [Comp] --ccFFFcccccc___FFFFFFFFcc_____FFF_F___FFFFF-FcccFFFc__FcFFcFFFFFFF_FF______ccFF______FFF_FFcFF__cFF : chn 2 [Actu] --00000QAAAAAAAAAAAAGGOG0000000QB0RG0000000000RR00000000QBGQAAAAAA00RG0000000QA3000000000000QAB00QAA : chn 2 [Res.] + GDTFAEKTGFDPRRLTTSYLYFRISPRRVQAWREANELSGRELRDGEWL : chn 2 [Pred] + 0**AAAA**0000000AAAA-0**0*AAAA*AB*AAA*0*0000*RA-- : chn 2 [Accu] + 84357863369969855669-95562566659936563633555264-- : chn 2 [Mult] + _22____22___________-_22_4____2__3___2_2____2__-- : chn 2 [Comp] + Fcc___FccF_FFFFFFFFF-_cc_cFFFFcFFcF_FcFcFFF_c_F-- : chn 2 [Actu] + AAAAAAB0RG0QABGRG000000000O0000000QAHQABRGO0RRG-- : chn 2 Statistics Success rate = 0.2730 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2IAB.code Extended success rate = 0.4983 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2IAB.code Coverage = 0.9863 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2IAB.code Mult candidate rate = 0.2253 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2IAB.code Ave. accuracy = 0.5730 : ./PDBdata/TBM/2IAB.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.