[Res.] SEGSADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQVSSAADAARLAVRMENDGATAWRA : chn 1 [Pred] --*R0R**AAAAAAAAAB0-00000AAA000QA**AAAAAAAAAA*0---RR***AAAA*00000AAA*R**A--0*00AAAAAAAAAAA00*R0AAAAA : chn 1 [Accu] --36433556766865569-998664553565533563668867439---99555655525667655534459--9584576677775575334655866 : chn 1 [Mult] --3___22___________-_____________33__________3_---__222____2________2_22_--_2_______________2_______ : chn 1 [Comp] --cFFFcc_________FF-FFFFF___FFFFFccF_________cF---FFccc____cF____FFFcFccF--_c__F__________FFcFF_____ : chn 1 [Actu] --AAAAAAAAAAAAAAAAAAAAAAAAAAA8G0QAHQAAAAAAAAAAAAAAAAAAAAAAABR0000000R00O0R00000QAAAAAAAAAAAAAAAAAAAA : chn 1 [Res.] + VVEHAETADDRVFASTALTESAVMATRWNRVLGAWPITAAFP : chn 1 [Pred] + AAAA000QB*0AA*0AAAA*AAAAA*R0*AABR*0**AAA-- : chn 1 [Accu] + 8665557333555263454335566599567444625796-- : chn 1 [Mult] + _________2___4_____2_____2__2____2_42___-- : chn 1 [Comp] + ___F_FF_FcF__cF____c_____cFFc__FFcFccFFF-- : chn 1 [Actu] + AAA30RGQAAAAAAAAAAAAAAAAAAAAAAAAABG00000-- : chn 1 [Res.] SEGSADNAALCDALAVEHATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAPIAAAGYQLPMQVSSAADAARLAVRMENDGATAWRA : chn 2 [Pred] --*R0R**AAAAAAAAAB0-00000AAA000QA**AAAAAAAAAA*0---RR***AAAA*00000AAA*R**A--0*00AAAAAAAAAAA00*R0AAAAA : chn 2 [Accu] --36433556766865569-998664553565533563668867439---99555655525667655534459--9584576677775575334655866 : chn 2 [Mult] --3___22___________-_____________33__________3_---__222____2________2_22_--_2_______________2_______ : chn 2 [Comp] --cFFFcc_________FF-FFFFF___FFFFFccF_________cF---FFccc____cF____FFFcFccF--_c__F__________FFcFF_____ : chn 2 [Actu] --QAAAAAAAAAAAAAAAAAAAAAAAAAABG0QABQAAAAAAAAAAAAAAAAAAAAAAABR0000000R0000R00000QAAAAAAAAAAAAAAAAAAAA : chn 2 [Res.] + VVEHAETADDRVFASTALTESAVMATRWNRVL : chn 2 [Pred] + AAAA000QB*0AA*0AAAA*AAAAA*R0RQ-- : chn 2 [Accu] + 866555733355526345433556659999-- : chn 2 [Mult] + _________2___4_____2_____2____-- : chn 2 [Comp] + ___F_FF_FcF__cF____c_____cFFFF-- : chn 2 [Actu] + AAA00RGQAAAAAAAAAAAAAAAAAAAAAA-- : chn 2 Statistics Success rate = 0.4812 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2IB0.code Extended success rate = 0.6391 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2IB0.code Coverage = 0.9549 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2IB0.code Mult candidate rate = 0.1579 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2IB0.code Ave. accuracy = 0.5934 : ./PDBdata/TBM/2IB0.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.