[Res.] SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDTLYIVMEYCEGGDLASVITKGTKERQ : chn 1 [Pred] --AA*0000000000000A**R100AQB0000***000QR000QAAA**AA*AAAAAAAA*0QBG0*A*A0**AAA000000*RR000AAA**000QAAA : chn 1 [Accu] --95379868867685565435345435457555596646586688655854564777653865685934645555899999554364446456655658 : chn 1 [Mult] --__3______________23___________222____________22__2________2_____2_3__22_________2________22_______ : chn 1 [Comp] --F_cF__F__F___FF_FccFF__FFFF___ccc____FFF_____cc__c______FFc_____cFcF_ccFFF______cFF__F___ccFFFFFFF : chn 1 [Actu] --QABG00R00R000QB00000000QB0R000000000QQBG0QAAAAAAAAAAAAAAGG00QBG00000000O300000000QB00QAAAAAAAAABR0 : chn 1 [Res.] + YLDEEFVLRVMTQLTLALKECHRRSDLKPANVFLDGKQNVKLGDFGLARILGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAG : chn 1 [Pred] + AA0QA0AA*AAAAAAAAAAAA***G000000000RR00R00000RQQ0AABR00-RG0QAAA---000QA0AAAAAAAAAAAABQ0000*AAAAAAAAAR : chn 1 [Accu] + 435453455699555665669535936855699655587786754333465569-9999999---99954645668899999999999936569788646 : chn 1 [Mult] + ________2____________232______________________________-_______---________________________3__________ : chn 1 [Comp] + FF___F__c____________cccFF__FFFF__FFFFF_____FFFF_FFF__-FF_____---_____F____________FFFF_FcFFFFF____F : chn 1 [Actu] + 000QAAAAAAAAAAAAAAAAAAABPJ00QABG000QGR000000QAAAAB9200QB00QAAABR0000QAAAAAAAAAAAAAAABRG0R000R0QAAAAA : chn 1 [Res.] + KIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH : chn 1 [Pred] + G000R*00-000B000QAAAAAAAAAAA****000QAAAAA0*AA000000-- : chn 1 [Accu] + 36436469-999565547978799965522336588999853355556766-- : chn 1 [Mult] + _____2__-___________________4533__________2________-- : chn 1 [Comp] + FFFF_c__-__F_F_FF________FFFccccF_______FFcFF_FFFF_-- : chn 1 [Actu] + AAABR000000QBG0QAAAAAAAAAB0RGQABG00QAAAABGQBG0QABG0-- : chn 1 Statistics Success rate = 0.5141 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2JAV.code Extended success rate = 0.6265 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2JAV.code Coverage = 0.9799 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2JAV.code Mult candidate rate = 0.1124 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2JAV.code Ave. accuracy = 0.6582 : ./PDBdata/TBM/2JAV.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.