[Res.] STARPLKSVDYEVFGRVQGVCFRMYAEDEARKIGVVGWVKNTSKGTVTGQVQGPEEKVNSMKSWLSKVGSPSSRIDRTNFSNEKTISKLEYSNFSVRY : chn 1 [Pred] ---*RG*00000000R0GR0RRG*AA*BAAAAB*00000000Q*00*0*0*000*AAA*AAABQAA0000*00*R0000*00**00A*0RGR0R-0-- : chn 1 [Accu] ---5693999995579849999959657999995699999996587395959995666399994594999399599999599559965999999-9-- : chn 1 [Mult] ---2__3________________2__2______2_________2__3_2_2___2___3___________3__2_____2__22___2______-_-- : chn 1 [Comp] ---c__c______FF__F_____c__cF_____c_________cFFc_c_c___c___c____FF_F___c__c_____c__cc__Fc______-_-- : chn 1 [Actu] --BGRG0000000RRR01R0RRGQAAAAAAAABR00000000QGRR300000001AAAAAAABHQAB000R000R00000000000000RGR0R00-- : chn 1 Statistics Success rate = 0.6915 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/a_and_b_1aps/pdb1aps.code Extended success rate = 0.8723 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/a_and_b_1aps/pdb1aps.code Coverage = 0.9787 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/a_and_b_1aps/pdb1aps.code Mult candidate rate = 0.1809 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/a_and_b_1aps/pdb1aps.code Ave. accuracy = 0.8236 : ./PDBdata/a_and_b_1aps/pdb1aps.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.