[Res.] VRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFN : chn 1
[Pred] --A-000*00***000*0*0RG00A*00000QAAA**-0--0000*0**--R000*00R0**BRG000A0000R*0*0*00000QA*0O0QB00Q0BG00 : chn 1
[Accu] --9-999596555699595995998549999999955-9--99995955--9999565653346669969996958575969699959966995966999 : chn 1
[Mult] --_-___2__222___2_2______2_________22-_--____2_22--____2____22____________2_2_2_______2_____________ : chn 1
[Comp] --F-___c__ccc___c_c__F__Fc_________cc-_--____c_cc--FF__c__F_ccF_____F___F_c_c_c______Fc________F____ : chn 1
[Actu] --00000000QBR00000R0R0000000000QAAABG000O000000000QGG00000000RGRG0000000RRG000000000Q9B0O0QB00QABG00 : chn 1

[Res.] + KIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS : chn 1
[Pred] + 0000R*G00000QB0-RG0*0*0**0*00000-0B0--0000G000--A-- : chn 1
[Accu] + 699995969979996-9995955559599998-699--55975999--9-- : chn 1
[Mult] + _____2_________-___2_2_22_2_____-___--________--_-- : chn 1
[Comp] + ____Fc_________-_F_c_c_cc_c_____-FF_--___F____--F-- : chn 1
[Actu] + 00000RG00000QB00R000000RG0R000000RG000000RG000000-- : chn 1

Statistics
  Success rate          = 0.6327    (= #'_' / (#aa - #chn * 4))          : ./PDBdata/b_1i1b/pdb1i1b.code
  Extended success rate = 0.8027    (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/b_1i1b/pdb1i1b.code
  Coverage              = 0.9184    (= (#aa - #'-') / (#aa - #chn * 4))  : ./PDBdata/b_1i1b/pdb1i1b.code
  Mult candidate rate   = 0.1701    (= #'*' / (#aa - #chn * 4))          : ./PDBdata/b_1i1b/pdb1i1b.code
  Ave. accuracy         = 0.8092                                         : ./PDBdata/b_1i1b/pdb1i1b.code

// Remarks
// (0) Genaral 
//     '-' means no entry in the frag_code.tbl table.
// (1) Statistics 
//     2 amino acids at both ends of chains are excluded from computation.
//     '#aa' denotes the number of all amino acids.
//     '#chn' denotes the number of all chains.
// (2) [pred] entry 
//     '*' means multiple candidates for the position.
// (3) [accu] entry 
//     Accuracy = #{occurrence of the predicted code in the conversion table} / 
//                           #{occurrence of the amino acid fragment in the table}. 
//     (In the case of multiple candidates, the occurence of one of them is considered.)
//     And 'n' means prediction accuracy is greater than or equal to n / 10.
// (4) [mult] entry 
//     '_' means single candidate.
//     'n' denotes the number of candidates.
//     'U' means the number of candidates is greater than 9.
// (5) [comp] entry 
//     '_' means successful prediction.
//     'F' means prediction failure.
//     'c' means the actual code is contained in the condidates.