[Res.] ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNA : chn 1 [Pred] --QAAAAAAAAAAAAAAA*AO**AAAAAAAAAAAAAAAAAABG00QAB0BG0QB0QAAAAAAAAA*AAAAAAAAAAAAAABRA0AAAAAAAAAAAAAA0A : chn 1 [Accu] --46688997765666674433488899998887888776785785543227774966768886745444666988765535336888878998654357 : chn 1 [Mult] --________________2__22__________________________________________2__________________________________ : chn 1 [Comp] --________________cF_cc_________________________F________________c________________FF______________F_ : chn 1 [Actu] --QAAAAAAAAAAAAAAAB0O0QAAAAAAAAAAAAAAAAAABG00QABQBG0QB0QAAAAAAAAAAAAAAAAAAAAAAAABRRQAAAAAAAAAAAAAAAA : chn 1 [Res.] + YHQKYR : chn 1 [Pred] + AAAG-- : chn 1 [Accu] + 8999-- : chn 1 [Mult] + ____-- : chn 1 [Comp] + ____-- : chn 1 [Actu] + AAAG-- : chn 1 [Res.] ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNA : chn 2 [Pred] --QAAAAAAAAAAAAAAA*AO**AAAAAAAAAAAAAAAAAABG00QAB0BG0QB0QAAAAAAAAA*AAAAAAAAAAAAAABRA0AAAAAAAAAAAAAA0A : chn 2 [Accu] --46688997765666674433488899998887888776785785543227774966768886745444666988765535336888878998654357 : chn 2 [Mult] --________________2__22__________________________________________2__________________________________ : chn 2 [Comp] --________________cFFcc_________________________F________________c________________FF______________F_ : chn 2 [Actu] --QAAAAAAAAAAAAAAAB0R0QAAAAAAAAAAAAAAAAAABG00QABQBG0QB0QAAAAAAAAAAAAAAAAAAAAAAAABRRQAAAAAAAAAAAAAAAA : chn 2 [Res.] + YHQKYR : chn 2 [Pred] + AAAG-- : chn 2 [Accu] + 8999-- : chn 2 [Mult] + ____-- : chn 2 [Comp] + ____-- : chn 2 [Actu] + AAAG-- : chn 2 Statistics Success rate = 0.9069 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/a_256b/pdb256b.code Extended success rate = 0.9461 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/a_256b/pdb256b.code Coverage = 1.0000 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/a_256b/pdb256b.code Mult candidate rate = 0.0392 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/a_256b/pdb256b.code Ave. accuracy = 0.6945 : ./PDBdata/a_256b/pdb256b.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.