[Code] --00RG000RG0O0000000000RG0000QABG0000000QAAAAAAAAAQAAAAAAAQAABRQG0QBG00000000RRG00000RRRRRG000000000 : chn 1 [Pred] ------**G*TLPVQSGWVLVKGGKSLKLAEDLVVVVGGSPEELEALLAALPKFLK**------VPPDSGTVVVVLVDGKLVLVSNTNGGIIVVV*G*HV : chn 1 [Hit.] ------0122233UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU952------0124UUUUUUUUUUUUUUUUUU56777UUUUU9988 : chn 1 [Accu] ------2132316101111111231111112211111112121111211112111111------643410011110126211110232231111211111 : chn 1 [Mult] ------27_2______________________________________________22------_______________________________2_2__ : chn 1 [Comp] ------ccFcFF_FFFFFFFFF_FFFFF__FFFFFFFFF_FFFFFF_FF_F_FFFFcc------FF_FFFFF_FFFFF_FFFFFFFFFFFFF_FFcFcFF : chn 1 [Res.] DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLKQLELLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPT : chn 1 [Code] + 001Q-- : chn 1 [Pred] + GPG*E* : chn 1 [Hit.] + 874333 : chn 1 [Accu] + 111111 : chn 1 [Mult] + ___2_2 : chn 1 [Comp] + FFFcFc : chn 1 [Res.] + PEKNLE : chn 1 [Code] --G00RG000RG0O0000000000RG0000QABG0000000QAAAAAAAAAQAAAAAAAAAABRQG0QBG00000000RRG00000RRR0R000000000 : chn 2 [Pred] -------**G*TLPVQSGWVLVKGGKSLKLAEDLVVVVGGSPEELEALLAALPALA*LILRATGL*PPDSGTVVVVLVDGKLVLVLDG*ADYAIVLVIL* : chn 2 [Hit.] -------0122233UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU64333534UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU : chn 2 [Accu] -------213231610111111123111111221111111212111111111101111121116122441001111012621111013121111111110 : chn 2 [Mult] -------27_2_____________________________________________3________2______________________2__________2 : chn 2 [Comp] -------ccFcFF_FFFFFFFFF_FFFFF__FFFFFFFFF_FFFFFF_FF_F_F_Fc_F_FFF_FcF_FFFFF_FFFFF_FFFFFFFFcFFFFFF_FFFc : chn 2 [Res.] HDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLKQLELLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYP : chn 2 [Code] + -- : chn 2 [Pred] + GG : chn 2 [Hit.] + U8 : chn 2 [Accu] + 11 : chn 2 [Mult] + __ : chn 2 [Comp] + FF : chn 2 [Res.] + TP : chn 2 Statistics Success rate = 0.1346 (= #'_' / (#aa - #chn * 0)) : ./PDBdata/TBM_FM/2H28.code Extended success rate = 0.2115 (= (#'_' + #'c') / (#aa - #chn * 0)) : ./PDBdata/TBM_FM/2H28.code Coverage = 0.9087 (= (#aa - #'-') / (#aa - #chn * 0)) : ./PDBdata/TBM_FM/2H28.code Mult candidate rate = 0.0769 (= #'*' / (#aa - #chn * 0)) : ./PDBdata/TBM_FM/2H28.code Ave. accuracy = 0.1882 : ./PDBdata/TBM_FM/2H28.code // Remarks // (0) General // 'The [Res.] and the [Code] entries show the actual sequences of residues and codes respectively. // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 0 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [Pred] entry // The predicted amino-acid sequence is shwon. // '*' means multiple candidates for the position. // (3) [Hit.] entry // Hit count = #{occurrence of the code-fragment in the conversion table} // 'n' means hit count is greater than or equal to n * 10. // 'U' means hit count is greater than 99. // (4) [Accu] entry // Accuracy = #{occurrence of the predicted amino-acid-fragment in the conversion table} / // #{occurrence of the code-fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (5) [Mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (6) [Comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.