[Code] --000000000001G033000000RGRGQAAAAAAAAAAAAABRRRRG000QABG000000000QAAAAAAA0RR0000RR1R-- : chn 1
[Pred] GS*AV*TLVVH*G*DD--YVLL*TKSPDPEEAAAALAALLKALGLGNRKLTPEDIGVVVVVGGSPEELEALLQ*GS--------- : chn 1
[Hit.] 0111111111111110--1358UUUUUUUUUUUUUUUUUUUUUUUU76UUUUUUUUUUUUUUUUUUUUUUUU1000--------- : chn 1
[Accu] 2212422322224222--1222222312111111111111111511111211231111111111121111213599--------- : chn 1
[Mult] __6__2_____2_2__--____2__________________________________________________2__--------- : chn 1
[Comp] FFcF_cFFF_FcFcFF--FFFFc_FFF_FFF_FFFFFFF_FFF_FFFFFF_F_FFFFFFFFFFFF_FF__FF_c_F--------- : chn 1
[Res.] MQIHVYDTYVKAKDGHVMHFDVFTDVRDDKKAIEFAKQWLSSIGEEGATVTSEECRFCHSEKAPDEVIEAIKQNGYFIYKMEGCN : chn 1

Statistics
  Success rate          = 0.1647    (= #'_' / (#aa - #chn *  0))          : ./PDBdata/FM/2HFQ.code
  Extended success rate = 0.2353    (= (#'_' + #'c') / (#aa - #chn *  0)) : ./PDBdata/FM/2HFQ.code
  Coverage              = 0.8706    (= (#aa - #'-') / (#aa - #chn *  0))  : ./PDBdata/FM/2HFQ.code
  Mult candidate rate   = 0.0706    (= #'*' / (#aa - #chn *  0))          : ./PDBdata/FM/2HFQ.code
  Ave. accuracy         = 0.2255                                          : ./PDBdata/FM/2HFQ.code

// Remarks
// (0) General 
//     'The [Res.] and the [Code] entries show the actual sequences of residues and codes respectively.
//     '-' means no entry in the frag_code.tbl table.
// (1) Statistics 
//     0 amino acids at both ends of chains are excluded from computation.
//     '#aa' denotes the number of all amino acids.
//     '#chn' denotes the number of all chains.
// (2) [Pred] entry 
//     The predicted amino-acid sequence is shwon.
//     '*' means multiple candidates for the position.
// (3) [Hit.] entry 
//     Hit count = #{occurrence of the code-fragment in the conversion table}
//     'n' means hit count is greater than or equal to n * 10.
//     'U' means hit count is greater than 99.
// (4) [Accu] entry 
//     Accuracy = #{occurrence of the predicted amino-acid-fragment in the conversion table} / 
//                           #{occurrence of the code-fragment in the table}. 
//     (In the case of multiple candidates, the occurence of one of them is considered.)
//     And 'n' means prediction accuracy is greater than or equal to n / 10.
// (5) [Mult] entry 
//     '_' means single candidate.
//     'n' denotes the number of candidates.
//     'U' means the number of candidates is greater than 9.
// (6) [Comp] entry 
//     '_' means successful prediction.
//     'F' means prediction failure.
//     'c' means the actual code is contained in the condidates.