[Code] --AAAAAAAAAAAAABR00R00000RQAG0QB00000000R0QAAAAAAAAAAAAAAAABR000R000RQGRRR0000000RG00013QAAAAIBRQAAA : chn 1 [Pred] EAAAAAAALAALLLALGLPDVVLVDNQKFKGAGGVVVVVAASPEEAAALLAALLALLLALGIPVDGVLGDD*GQ*FTIYESPFP*V-----------ALE : chn 1 [Hit.] UUUUUUUUUUUUUUUUUUUUUUUU70000123UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU200000000000000000-----------111 : chn 1 [Accu] 01111111111111115111112213799233111111111211111111111111111151121111259353333333363424-----------422 : chn 1 [Mult] _______________________________________________________________________2__2_________3_-----------___ : chn 1 [Comp] _FFFFFFFFFFF_FFFFFF_FFFF_FF_FFFFFFFF_FFFF_FFFFF__FFFFFFF_FFF_FFFF_FF_FFc_FcFFFFFFFFFcF-----------FFF : chn 1 [Res.] EIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVLVDAGDVVVHVLPAVRDYYDIEAL : chn 1 [Code] + BR000000RG00QGQ-- : chn 1 [Pred] + LGIKVI**GF*L----- : chn 1 [Hit.] + 111111111111----- : chn 1 [Accu] + 362242124222----- : chn 1 [Mult] + ______52__2_----- : chn 1 [Comp] + F_FFFFccFFcF----- : chn 1 [Res.] + WGGQKPSFAVGAAKPWS : chn 1 [Code] --AAAAAAAAAAAAABR00R00000RQAG0QB00000000R0QAAAAAAAAAAAAAAAABR000R000RQGRRG0000000RG00013QAAAAIBRQAAA : chn 2 [Pred] EAAAAAAALAALLLALGLPDVVLVDNQKFKGAGGVVVVVAASPEEAAALLAALLALLLALGIPVDGVL*KENGLAWYQQKPGKSPK-----------ALE : chn 2 [Hit.] UUUUUUUUUUUUUUUUUUUUUUUU70000123UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU200555555555555555-----------111 : chn 2 [Accu] 01111111111111115111112213799233111111111211111111111111111151121111155222254444443342-----------422 : chn 2 [Mult] ____________________________________________________________________2_________________-----------___ : chn 2 [Comp] _FFFFFFFFFFF_FFFFFF_FFFF_FF_FFFFFFFF_FFFF_FFFFF__FFFFFFF_FFF_FFFF_FFcF_F_FFFFFFFFFFFFF-----------FFF : chn 2 [Res.] EIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVLVDAGDVVVHVLPAVRDYYDIEAL : chn 2 [Code] + BR000000RG00QGQ-- : chn 2 [Pred] + LGIKVI**GF*L----- : chn 2 [Hit.] + 111111111111----- : chn 2 [Accu] + 362242124222----- : chn 2 [Mult] + ______52__2_----- : chn 2 [Comp] + F_FFFFccFFcF----- : chn 2 [Res.] + WGGQKPSFAVGAAKPWS : chn 2 Statistics Success rate = 0.1282 (= #'_' / (#aa - #chn * 0)) : ./PDBdata/TBM/2ID1.code Extended success rate = 0.1709 (= (#'_' + #'c') / (#aa - #chn * 0)) : ./PDBdata/TBM/2ID1.code Coverage = 0.8632 (= (#aa - #'-') / (#aa - #chn * 0)) : ./PDBdata/TBM/2ID1.code Mult candidate rate = 0.0427 (= #'*' / (#aa - #chn * 0)) : ./PDBdata/TBM/2ID1.code Ave. accuracy = 0.2493 : ./PDBdata/TBM/2ID1.code // Remarks // (0) General // 'The [Res.] and the [Code] entries show the actual sequences of residues and codes respectively. // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 0 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [Pred] entry // The predicted amino-acid sequence is shwon. // '*' means multiple candidates for the position. // (3) [Hit.] entry // Hit count = #{occurrence of the code-fragment in the conversion table} // 'n' means hit count is greater than or equal to n * 10. // 'U' means hit count is greater than 99. // (4) [Accu] entry // Accuracy = #{occurrence of the predicted amino-acid-fragment in the conversion table} / // #{occurrence of the code-fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (5) [Mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (6) [Comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.