[Code] --000000RRRG000000R0QB0000000R000QB0QAAABRGG00B000R00RRG0R0R00QAAAAAAAABG0000000000RRRQR00-- : chn 1 [Pred] GS*VSVDGNGGK*LVVVVLGPEGSLVLVG**PP*TNPE*V-----------**NGVSLEGLTPEEALELLLLLPGVPVVVLL***GK----- : chn 1 [Hit.] 6UUUUUUUUUUUUUUUUUUUUUUUUUUU822211111000-----------00001UUUUUUUUUUUUUUUUUUUUUUUUUUU5100----- : chn 1 [Accu] 1111111113311111111231411111111222546349-----------559731113221212111211111111111011259----- : chn 1 [Mult] __2_________2________________22__2____2_-----------22_____________________________242__----- : chn 1 [Comp] FFc_FFFFFF_FcFFFF_FF_F_FFFFFFccFFc_FFFcF-----------ccF_F_F__F_FFF_FF__FFFF_FFFFFFFcccFF----- : chn 1 [Res.] LRTVEMKKSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSETSV : chn 1 [Code] --AAAAAABR0000000001RR0RRG000000R0QB0R00000R0000OJ000R000R00RRG0R0R00QAAAAAAAABG00000000000RRG000-- : chn 2 [Pred] ALAEALKELGIPVVLVVVGGHG*NGE*KYVLGVAPSASLYAVK*AQRV--L**GD****VNGVSLEGLTPEEALELLKLLPGVVVVVVVVVDGKLVLV* : chn 2 [Hit.] UUUUUUUUUUUUUUUUUUU10000000123333333333332210000--0000000000011UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU : chn 2 [Accu] 111112111611211111134726662223323253223232335434--6339933324882211322121211121111111111111126211110 : chn 2 [Mult] ______________________4___2________________2____--_33__3335_______________________________________2 : chn 2 [Comp] FFFFFFFFF_FFF_FFFF_FFFcF_FcFFFFFFF_FFFFFFFFcFFFF--_cc__ccccFF_F_F__F_FFF_FF___FFF_FFFFF__FFFFFFFFFc : chn 2 [Res.] TENLYFQSMGLRTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSETSV : chn 2 Statistics Success rate = 0.1832 (= #'_' / (#aa - #chn * 0)) : ./PDBdata/TBM/2IWO.code Extended success rate = 0.2932 (= (#'_' + #'c') / (#aa - #chn * 0)) : ./PDBdata/TBM/2IWO.code Coverage = 0.9058 (= (#aa - #'-') / (#aa - #chn * 0)) : ./PDBdata/TBM/2IWO.code Mult candidate rate = 0.1099 (= #'*' / (#aa - #chn * 0)) : ./PDBdata/TBM/2IWO.code Ave. accuracy = 0.2709 : ./PDBdata/TBM/2IWO.code // Remarks // (0) General // 'The [Res.] and the [Code] entries show the actual sequences of residues and codes respectively. // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 0 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [Pred] entry // The predicted amino-acid sequence is shwon. // '*' means multiple candidates for the position. // (3) [Hit.] entry // Hit count = #{occurrence of the code-fragment in the conversion table} // 'n' means hit count is greater than or equal to n * 10. // 'U' means hit count is greater than 99. // (4) [Accu] entry // Accuracy = #{occurrence of the predicted amino-acid-fragment in the conversion table} / // #{occurrence of the code-fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (5) [Mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (6) [Comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.