[Code] --B0000R000000R0000000000QB0QB000000000O0RG0000000RR00000R00QBG000000RG000000R00QABGG00000000QABRG00 : chn 1
[Pred] *ED*VQPGSLVVSPGGGVTVVVVVSPSDPGSN*VIWYQQPPGQSPKLLIYYASNLASGVPSRFSGSGSGTDASLTISSLTSEDSAVYYCARYDPSLGAVV : chn 1
[Hit.] 245UUUUUUUUUUUUUUUUUUUUUUUUUUUU998887665UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU : chn 1
[Accu] 1121111111111121011111110121323113223234573475678714734268783875654463221412336457948474532232212111 : chn 1
[Mult] 2__2____________________________2___________________________________________________________________ : chn 1
[Comp] cFFcF__F_FFFF__FF__FFFFF_FF_F___c______F__FF_______FFF_F___FF___F_F___F___F__F_F___F_F____FFFF__FFFF : chn 1
[Res.] ESVLTQPPSASGTPGQRVTISCTGSATDIGSNSVIWYQQVPGKAPKLLIYYNDLLPSGVSDRFSASKSGTSASLAISGLESEDEADYYCAAWNDSLDEPG : chn 1

[Code] + 00R0000000R0-- : chn 1
[Pred] + VVGGTVVVSGGGPV : chn 1
[Hit.] + UUUUUUUUUUUUUU : chn 1
[Accu] + 01211112112211 : chn 1
[Mult] + ______________ : chn 1
[Comp] + FF___FFFFF_F_F : chn 1
[Res.] + FGGGTKLTVLGQPK : chn 1

Statistics
  Success rate          = 0.5175    (= #'_' / (#aa - #chn *  0))          : ./PDBdata/b_2rhe/pdb2rhe.code
  Extended success rate = 0.5439    (= (#'_' + #'c') / (#aa - #chn *  0)) : ./PDBdata/b_2rhe/pdb2rhe.code
  Coverage              = 1.0000    (= (#aa - #'-') / (#aa - #chn *  0))  : ./PDBdata/b_2rhe/pdb2rhe.code
  Mult candidate rate   = 0.0263    (= #'*' / (#aa - #chn *  0))          : ./PDBdata/b_2rhe/pdb2rhe.code
  Ave. accuracy         = 0.3382                                          : ./PDBdata/b_2rhe/pdb2rhe.code

// Remarks
// (0) General 
//     'The [Res.] and the [Code] entries show the actual sequences of residues and codes respectively.
//     '-' means no entry in the frag_code.tbl table.
// (1) Statistics 
//     0 amino acids at both ends of chains are excluded from computation.
//     '#aa' denotes the number of all amino acids.
//     '#chn' denotes the number of all chains.
// (2) [Pred] entry 
//     The predicted amino-acid sequence is shwon.
//     '*' means multiple candidates for the position.
// (3) [Hit.] entry 
//     Hit count = #{occurrence of the code-fragment in the conversion table}
//     'n' means hit count is greater than or equal to n * 10.
//     'U' means hit count is greater than 99.
// (4) [Accu] entry 
//     Accuracy = #{occurrence of the predicted amino-acid-fragment in the conversion table} / 
//                           #{occurrence of the code-fragment in the table}. 
//     (In the case of multiple candidates, the occurence of one of them is considered.)
//     And 'n' means prediction accuracy is greater than or equal to n / 10.
// (5) [Mult] entry 
//     '_' means single candidate.
//     'n' denotes the number of candidates.
//     'U' means the number of candidates is greater than 9.
// (6) [Comp] entry 
//     '_' means successful prediction.
//     'F' means prediction failure.
//     'c' means the actual code is contained in the condidates.