• Backbone structures are obtained using ProteinViewer, where N-terminal is colored red and C-terminal blue.
• Click the images to view larger image.
• Click PDB IDs to view the corresponding PDB file
• See the bottom for explanation of the DSSP codes and the 5-tile codes. 

(1) Retinol Binding Protein (1hbq) and Thrombin Inhibitor Triabin (1avg)

			"Triabin shares significant and easily detectable sequence similarity with retinol-binding proteins and structurelly is more similar to them than any other protein family. However, the N-terminal regions of the structures (beta-strand abcd ...) are topologically distinct and thus triabin and retinol-binding protein can be classified into different folds." (Grishin, 2001)
1hbq (Res15-142)	1avg (ResI15-132)

1hbq KAR FAGTWYAMAKKDPEGL FLQDN  IVAEFSVDENGQMSAT    AKGRVR LLNNWDVCAD   MVGTFTD TE DPA code QAA BG00000R000000R0 0001R  00000000QBR00000    000000 0QBR000000   0000000 0R GQB LCS  QAA BG00000 0     R0 00  R  00000000  R    0    000000 0QB      0   0000000 0R G code QAAHBG00000 0     R0R00  RGO00000000  R    0RRRR000000R0QBG     0QBG0000000R0RRGR 1avg PEEFFNGTWYL A     HGPGV  TSPAVCQKFTT  S    GSKGFTQIVEIGYNKF     ESNVKFQCNQVDNKNGE 1hbq KFKMKYWGVASFLQKGNDDHWIIDTD YETFAVQYSCRLLNLDGTCADSYSFVFA  RD code G0000000RGQBG000000000R00R QG00000000R000QBRG0R00000000  RG LCS  G0000000  QB 000000000 00  Q 00000000 000  RG0 00000000  RG code G0000000  QBR000000000 0000QB00000000 000  RG0 0000000000RG 1avg QYSFKCKS  SDNTEFEADFTF ISVSYDNFALVCRS ITF  TSQ PKEDRYLVFERT *RATIO :  lcs/trimmed_seq_a = 0.742 (=   92/  124), lcs/trimmed_seq_b = 0.807 (=   92/  114)

Structural alignment by ComSubstruct

DSSP LLLLLL.LEEEEEEEeelllllllLEEEeeeeeellLLLEeeeeeeeeellllleEEEEEEEEEEE.LLLLl 1hbq FDKARF.AGTWYAMAkkdpeglflQDNIvaefsvdeNGQMsatakgrvrllnnwdVCADMVGTFTD.TEDPa      |    |  ||||                                                     | 1avg FKPEEFfNGTWYLAH....gpgvtSPAV.cqkfttsGSKG..ftqiveigynkfeSNVKFQCNQVDnKNGE. DSSP LLHHHHlLLEEEEEL....lllllLLEE.eeeeellLLLL..leeeeeellllllLLLEEEEEELLlLLLL. DSSP EEEEEEEELLllLLLEEEEEEEEEELLLLEEEEEEEEeellllleEEEEEEEEELLLL 1hbq KFKMKYWGVAsfLQKGNDDHWIIDTDYETFAVQYSCRllnldgtcADSYSFVFARDPS          |             |   |   |  ||                    || |  | 1avg QYSFKCKSSD..NTEFEADFTFISVSYDNFALVCRSI..tftsqpKEDRYLVFERTKS DSSP LEEEEEEELL..LLLEEEEEEEEEELLLLEEEEEEEE..eellllLLEEEEEEELLLL *Z-score 6.3  AR 85  RMSD 2.6A  SI 20%

Structural alignment by DaliLite

(2) Alanine Racemase C-terminal domain (1sft) and Eukaryotic Ornithine Decarboxylase C-terminal Domain (2tod)

			"Homology between 1sft and 2tod has been detected by sequence analysis. The structures of these PLP-dependent enzymes confirmed the presence of a beta-alpha-barrel domain and revealed unexpected structural differences in the C-terminal beta-domain. ... Surprisingly, however, the sequence similarity is the strongest in the region of the flip/swap." (Grishin, 2001)
1sft (ResA244-333)	2tod (ResA283-385)

1sft SLHSRLVHVKKL  QPGEKVSYGATYT        AQ  TEEWIGTIPIGYADGWLRRLQHFHVLVDGQKAPIVGRIC M      DQCMIRLPGPLPVGTK  VTL code 000000R00000  00000000RRRG0        00  00000000RG0QABRR0QABQBG0000RRG000000000 R      0000000R00001B00  00R LCS  000000R00000  0000000 R  G0        00  0000000 RG0             000R  000000000 R      0000000 0000  00  00 code 000000R00000PJ0000000 R  G0QBGQBQAB00BR0000000 RG0             000R  0000000000RGRGQBR0000000 0000  00RG0000 2tod TLAVNVIAKKVTPAQSFMYYV N  DGVYGSFNCILYDHAVVRPLP QRE             PIPN  EKLYPSSVWGPTCDGLDQIVERYY LPEM  QVGEWLLF *RATIO :  lcs/trimmed_seq_a = 0.733 (=   63/   86), lcs/trimmed_seq_b = 0.733 (=   63/   86)

Structural alignment by ComSubstruct

DSSP LLLEEEELLEEEEELllleelhhhleellLLEEEEEELLLHHHLLLHH...hhHLEEEELLE.............eeeeeLLLLllleeeelLLLLLLLLEEEEEl 1sft AFSLHSRLVHVKKLQpgekvsygatytaqTEEWIGTIPIGYADGWLRR...lqHFHVLVDGQ.............kapivGRICmdqcmirlPGPLPVGTKVTLIg      || |       |                           |                 |                      |                || 2tod AFTLAVNVIAKKVTP..............AQSFMYYVNDGVYGSFNCIlydhaVVRPLPQREpipneklypssvwgptcdGLDQ..iveryyLPEMQVGEWLLFEd DSSP LLLEEEEEEEEEEEL..............LLEEEEEELLLLLLHHHHHhhlllLLLLEELLLllllllleeeeeelllllLLLE..eeeeeeELLLLLLLEEEELl *Z-score 4.3  AR 60  RMSD 2.8A  SI 15%

Structural alignment by DaliLite

[The DSSP code]

• H = alpha helix
• B = residue in isolated beta-bridge
• E = extended strand, participates in beta ladder
• G = 3-helix (3/10 helix)
• I = 5 helix (pi helix)
• T = hydrogen bonded turn
• S = bend
• L = no assigned structure

[The 5-tile code]

• 0 = DDDDD    (extended strand, small blue spheres)
• 1 = DDDDU
• 2 = DDDUD
• 3 = DDDUU
• 8 = DUDDD
• 9 = DUDDU
• A = DUDUD    (helix, large red spheres)
• B = DUDUU    (turn, large yellow spheres)
• G = UDDDD
• H = UDDDU
• I = UDDUD
• J = UDDUU
• O = UUDDD
• P = UUDDU
• Q = UUDUD    (turn, large yellow spheres)
• R = UUDUU    (turn, large yellow spheres)