Superposition of the Ca traces (and D2 variable residues) |
Amino
acid code and Variable residue positions |
|
![]() |
CDR1
CDR2
CDR3
<-------> <-----> <--------> Amino Acid: PSALTQPPSASGSLGQSVTISCTGTSSNVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVT FLEX var.: xxxx xxxxxxxxx xxxx ANGL var.: xxx x xxxxx xxxxxx xxxx xx xxxx x x x xxxxxx xx D2 var.: -- x xxxxxx x x x x xx xxx x x PB var.: --xx xxxxxxxxxx xxxxxxxx xxx xxx x xxxxx xxx xxx xxxxx DSSP var.: x x xxx x x xxxxxxxxx x x xxx x xx x x x x |