[Res.] GTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEAQFYAVPVLPEQLVDRLDQSWQYYQDRLADFST : chn 1 [Pred] ----**0*0Q*00000R0*AAAAAAA*0QBG00000*R0000AA*AAAAAAAAAAAAA0A0R00QAAAAAA000000A*AAAAA***--AAAAAAAAA00 : chn 1 [Accu] ----34423646567749565787765755359999565665654664777666554654467746689996766843377775235--99698665365 : chn 1 [Mult] ----32_3__2_______2_______2_________2_______2_________________________________2_____332--___________ : chn 1 [Comp] ----ccFcFFcFFFFFFFc_____FFcFFFFFF_FFc_F__F__c____FFF______F_FF_________FF___F_cF____ccc--______FFF__ : chn 1 [Actu] --QAAAAAAAAAAAAAAAAAAAAABG0QAHQBG0QG0RG00QAAAAAAAB1QAAAAAAAAB000QAAAAAABG000QABQAAAAAAAAAAAAAAAJ3000 : chn 1 [Res.] + ETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIKLDLF : chn 1 [Pred] + 0000*0000QA*R0AAAAAAAA--GBAAAAAAAAABR000000-- : chn 1 [Accu] + 5769366643235487886869--9565555665533655699-- : chn 1 [Mult] + ____3______2__________--___________________-- : chn 1 [Comp] + ___Fc____FFcFF________--FF___________FF_F_F-- : chn 1 [Actu] + 000QB00000QAAAAAAAAAAAAAAAAAAAAAAAABRRR0R0R-- : chn 1 Statistics Success rate = 0.5319 (= #'_' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HKV.code Extended success rate = 0.6312 (= (#'_' + #'c') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HKV.code Coverage = 0.9574 (= (#aa - #'-') / (#aa - #chn * 4)) : ./PDBdata/TBM/2HKV.code Mult candidate rate = 0.0993 (= #'*' / (#aa - #chn * 4)) : ./PDBdata/TBM/2HKV.code Ave. accuracy = 0.6322 : ./PDBdata/TBM/2HKV.code // Remarks // (0) Genaral // '-' means no entry in the frag_code.tbl table. // (1) Statistics // 2 amino acids at both ends of chains are excluded from computation. // '#aa' denotes the number of all amino acids. // '#chn' denotes the number of all chains. // (2) [pred] entry // '*' means multiple candidates for the position. // (3) [accu] entry // Accuracy = #{occurrence of the predicted code in the conversion table} / // #{occurrence of the amino acid fragment in the table}. // (In the case of multiple candidates, the occurence of one of them is considered.) // And 'n' means prediction accuracy is greater than or equal to n / 10. // (4) [mult] entry // '_' means single candidate. // 'n' denotes the number of candidates. // 'U' means the number of candidates is greater than 9. // (5) [comp] entry // '_' means successful prediction. // 'F' means prediction failure. // 'c' means the actual code is contained in the condidates.